авторефераты диссертаций БЕСПЛАТНАЯ  БИБЛИОТЕКА

АВТОРЕФЕРАТЫ КАНДИДАТСКИХ, ДОКТОРСКИХ ДИССЕРТАЦИЙ

<< ГЛАВНАЯ
АГРОИНЖЕНЕРИЯ
АСТРОНОМИЯ
БЕЗОПАСНОСТЬ
БИОЛОГИЯ
ЗЕМЛЯ
ИНФОРМАТИКА
ИСКУССТВОВЕДЕНИЕ
ИСТОРИЯ
КУЛЬТУРОЛОГИЯ
МАШИНОСТРОЕНИЕ
МЕДИЦИНА
МЕТАЛЛУРГИЯ
МЕХАНИКА
ПЕДАГОГИКА
ПОЛИТИКА
ПРИБОРОСТРОЕНИЕ
ПРОДОВОЛЬСТВИЕ
ПСИХОЛОГИЯ
РАДИОТЕХНИКА
СЕЛЬСКОЕ ХОЗЯЙСТВО
СОЦИОЛОГИЯ
СТРОИТЕЛЬСТВО
ТЕХНИЧЕСКИЕ НАУКИ
ТРАНСПОРТ
ФАРМАЦЕВТИКА
ФИЗИКА
ФИЗИОЛОГИЯ
ФИЛОЛОГИЯ
ФИЛОСОФИЯ
ХИМИЯ
ЭКОНОМИКА
ЭЛЕКТРОТЕХНИКА
ЭНЕРГЕТИКА
ЮРИСПРУДЕНЦИЯ
ЯЗЫКОЗНАНИЕ
РАЗНОЕ
КОНТАКТЫ


Экспериментальные препараты на основе рекомбинантных днк и белков для лечения и профилактики инфекционных заболеваний

На правах рукописи

ЛЕБЕДЕВ

Леонид Рудольфович

ЭКСПЕРИМЕНТАЛЬНЫЕ ПРЕПАРАТЫ

НА ОСНОВЕ РЕКОМБИНАНТНЫХ ДНК И БЕЛКОВ

ДЛЯ ЛЕЧЕНИЯ И ПРОФИЛАКТИКИ

ИНФЕКЦИОННЫХ ЗАБОЛЕВАНИЙ

03.02.02 - вирусология

АВТОРЕФЕРАТ

диссертации на соискание ученой степени

доктора медицинских наук

Кольцово - 2010

2

Работа выполнена в Федеральном государственном учреждении науки «Государственный научный центр вирусологии и биотехнологии «Вектор» Федеральной службы по надзору в сфере защиты прав потребителей и благополучия человека (ФГУН ГНЦ ВБ «Вектор»

Роспотребнадзора).

Научный консультант доктор биологических наук, доцент Карпенко Лариса Ивановна

Официальные оппоненты доктор медицинских наук Орловская Ирина Анатольевна доктор биологических наук, профессор Беклемишев Анатолий Борисович доктор медицинских наук, профессор Вавилин Валентин Андреевич

Ведущая организация: Государственный научный центр «Институт иммунологии» ФМБА России, г. Москва

Защита состоится « 22 » апреля 2011 года в 1130 на заседании диссертационного совета Д.208.020.01 при ФГУН ГНЦ ВБ «Вектор»

Роспотребнадзора по адресу: 630559, р.п. Кольцово, Новосибирского района, Новосибирской области, тел.(8-383) 336-74-28.

С диссертацией можно ознакомиться в библиотеке ФГУН ГНЦ ВБ «Вектор» Роспотребнадзора.

Автореферат разослан « _ » 2011 года

Ученый секретарь диссертационного совета, доктор биологических наук Г.П. Трошкова

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность проблемы Инфекционные болезни остаются в современном мире одной из главных причин смертности, на их долю приходится до 30% регистрируемых летальных исходов на планете, что составляет 14–17 млн. случаев в год. В России ежегодно регистрируется до 35 млн. случаев инфекционных заболеваний, а прямые и косвенные потери от них составляют более 18 млрд.

руб. (Онищенко Г.Г., 2002). Увеличение числа иммунодефицитных состояний и возникновение резистентности у патогенов к лекарственным препаратам делают актуальной разработку новых эффективных средств, как для лечения, так и для профилактики инфекционных заболеваний.

В настоящее время в медицинской практике начинают активно использоваться лекарственные препараты, полученные на основе технологии рекомбинантных ДНК. Созданы иммунобиологические препараты генно инженерных белков: интерферона-, интерлейкина-1, интерлейкина-2, колониестимулирующих факторов и ряда других. Системный научный подход в сочетании с разработкой более совершенных технологий позволяют получать более эффективные и безопасные продукты. Сегодня на основе технологий рекомбинантных ДНК производится и разрабатывается ряд лекарственных средств, в том числе - цитокины. Цитокины относятся к сигнальным и эффекторным молекулам иммунной системы и обладают широким спектром биологической активности. Они определяют адекватный уровень иммунореактивности, с их участием осуществляется взаимодействие главных систем организма: иммунной, нервной, эндокринной. Они нашли применение при лечении таких социально значимых заболеваний как гепатиты, злокачественные новообразования, туберкулез. Поэтому разработка технологий получения этих препаратов в достаточных количествах является актуальной задачей. По подсчтам специалистов, ежегодный объм мирового рынка лекарственных средств на основе белков, созданных генно-инженерным путм, увеличивается на 15% и в 2010 году составит более 18 миллиардов долларов. Продукты биологического синтеза очень широко представлены в экономически развитых странах мира — США, Японии, Швейцарии, Германии. Это обеспечивает население защитой от инфекций, повышает уровень здоровья нации и способствует биологической безопасности государств.

Технологии рекомбинантных ДНК активно используются и при создании профилактических препаратов, в частности вакцин. Вакцинация является решающим фактором снижения детской смертности, увеличения продолжительности и улучшения качества жизни всех возрастных групп населения. По данным ВОЗ, вакцины ежегодно спасают жизнь 3 млн. детей. В настоящее время на разных стадиях экспериментальной разработки и клинических испытаний находятся вакцины, направленные на профилактику более 60-ти видов заболеваний. Современная вакцинология стремится к созданию более совершенных вакцин, которые должны быть эффективны, безопасны и не иметь побочных свойств (Медуницин Н.В., 2004).

Повышение требований к безвредности и чистоте препаратов стимулировало не только совершенствование традиционной вакцинологии, но и создание нового поколения искусственных вакцин: субъединичных, рекомбинантных, антиидиотипических, ДНК-вакцин, пероральных вакцин и др. (Семенов Б.Ф., 2009). Необходимость разработки новых вакцин связана также с решением проблемы борьбы с еще не побежденными инфекциями.

Среди них особую тревогу вызывают СПИД, гепатит, туберкулез. На сегодняшний день они входят в число наиболее социально значимых инфекционных заболеваний. Для получения таких вакцин необходимо, с одной стороны, генерировать новые идеи их создания, а с другой – решать технологические задачи, возникающие на каждом этапе продвижения препарата к потребительской форме.

Цели и задачи исследования Целью настоящей работы является получение иммунобиологических препаратов на основе рекомбинантных белков и ДНК для лечения и профилактики заболеваний человека.



В связи с целью исследования необходимо было решить следующие задачи:

1. Разработать методы повышения эффективности биосинтеза рекомбинантных цитокинов бактериальными продуцентами (на примере TNF-, TNF-, G-CSF и GM-CSF).

2. Получить рекомбинантные белки для создания на их основе средств терапии и профилактики инфекционных и неинфекционных заболеваний, разработать технологии их выделения и очистки:

препараты рекомбинантного человеческого интерферона- и его антагонистов;

препараты рекомбинантных цитокинов - факторов некроза опухолей и их антагонистов;

рекомбинантные антигены вируса иммунодефицита человека для создания вакцинных препаратов против ВИЧ/СПИД.

3. Создать молекулярные конструкции вирусоподобных нанобиочастиц в качестве вакцинных препаратов и получить их экспериментальные образцы на основе:

двуспиральной РНК и пептидов, двуспиральной РНК и рекомбинантных белков, рекомбинантных ДНК рекомбинантных ДНК и рекомбинантных белков.

4. Оценить иммунный ответ при иммунизации лабораторных животных созданными молекулярными конструкциями.

5. Исследовать влияние созданных препаратов цитокинов на иммунный ответ при их добавлении в состав разработанных экспериментальных вакцин.

Научная новизна и практическая значимость работы Впервые разработаны и внедрены методы повышения продуктивности рекомбинантных штаммов с плазмидами, содержащими в качестве генетического маркера ген bla, продуцирующих целевые белки-цитокины (патенты РФ № 2122580, № 2158303).

Разработаны технологии получения особо чистых препаратов рекомбинантных белков – цитокинов (патенты РФ № 2048521, № 2132389, № 2326944) и белков-антигенов, для создания на их основе вакцины против ВИЧ/СПИД. На разработки оформлена научно-техническая документация по производству и контролю качества и проекты фармакопейных статей.

Предложены методы очистки антагонистов интерферона и факторов некроза опухолей (патент РФ № 2376375).

Впервые предложены молекулярные конструкции, предназначенные для создания вакцинных композиций на основе искусственных вирусоподобных частиц с полинуклеотидным комплексом (ДНК или дсРНК) в центре и белками – на поверхности (патент РФ № 2217162).

Впервые показано, что полианионная оболочка плазмидной ДНК, состоящая из конъюгата полиглюкин-спермидин, способствует пролонгации циркуляции вводимого генетического материала в организме и проникновению его в клетки (патент РФ № 2190018).

Созданы экспериментальные вакцины против таких инфекций как ВИЧ/СПИД («TBI-ВПЧ» и «КомбиВИЧвак») (патент РФ №2317107) и туберкулез («Миковакс») (патент РФ № 2242245).

Впервые показано, что презентация иммунной системе искусственного антигена ВИЧ - белка TBI в составе нанобиочастиц способствует пролонгации иммунного ответа на этот белок и вызывает адъювантный эффект, сравнимый с эффектом, вызываемым введением полного адъюванта Фрейнда.

Впервые показано, что молекулярная конструкция позволяет экспонировать на поверхности частиц антигенные детерминанты белков одного вируса и доставлять плазмиды с генами, кодирующими синтез белков антигенов другого вируса, в антиген-презентирующие клетки. С использованием предложенного подхода созданы конструкции комбинированных искусственных иммуногенов, способные вызвать индукцию специфических антител против ВИЧ-1 и вируса клещевого энцефалита.

Исследована интенсивность и продолжительность гуморального и клеточного иммунных ответов на эти иммуногены.

В итоге предложено новое направление в создании вакцинных и терапевтических препаратов на основе рекомбинантных молекул белков и ДНК в виде вирусоподобных нанобиочастиц.

Продемонстрировано, что интерферон- в составе вакцинного препарата против туберкулеза способствует усилению клеточного иммунного ответа на вакцину.

Доклинические испытания экспериментальных серий вакцин против ВИЧ/СПИД показали, что они индуцируют специфический гуморальный и клеточный иммунный ответ. На кандидатные вакцины TBI-ВПЧ и КомбиВИЧвак оформлена научно-техническая документация на производство и контроль качества вакцин. Вакцина КомбиВИЧвак прошла предварительную регистрацию в Министерстве здравоохранения и социального развития РФ. В настоящее время получено разрешение от Комитета медицинских иммунобиологических препаратов (протокол №6 от декабря 2009г.) на проведение 1 фазы клинических испытаний.

Положения, выносимые на защиту:

1. Разработанный комплекс методов позволяет повысить содержание цитокинов в биомассах штаммов-продуцентов рекомбинантных белков, содержащих в плазмиде ген bla.

2. Созданные технологии выделения и очистки позволяют получать высокоочищенные препараты рекомбинантных белков медико биологического назначения: интерферона-, факторов некроза опухолей, а так же препараты их антагонистов (рецепторов).

3. Технологии выделения и очистки искусственных рекомбинантных полиэпитопных белков-антигенов вируса иммунодефицита человека (TBI и TCI) позволяют получать высокоочищенные препараты для создания и исследования кандидатных вакцин против ВИЧ/СПИД.

4. Созданная модель молекулярной конструкции нанобиочастиц эффективна для конструирования вакцинных композиций на основе искусственных вирусоподобных частиц содержащих полинуклеотидный комплекс (ДНК или дсРНК) в центре и белки-антигены – на поверхности.

5. Искусственные вирусоподобные частицы, полученные на основе самосборки за счет ионных и аффинных взаимодействий компонентов, содержащие дсРНК, конъюгат (декстран с субстратом фермента и спермидином) и гибридные белки, состоящие из фермента и антигена, обладают высокой иммуногенностью, обеспечивают пролонгированное образование антител.

6. Искусственные вирусоподобные частицы с дсРНК в центре, содержащие белки, ковалентно связанные с матрицей (конъюгат из декстрана с спермидином и белками), могут экспонировать на своей поверхности полный репертуар белков патогена и обладают высокой иммуногенностью.

7. Полианионная оболочка для плазмид, предназначенных для иммунизации, состоящая из конъюгата полиглюкин-спермидин, способствует пролонгации циркуляции ДНК плазмид в организме и проникновению ее в клетки.

8. На основе модели вирусоподобных частиц можно создавать конструкции, экспонирующие на поверхности антигенные детерминанты белков одного вируса и доставляющие плазмиды с генами, кодирующими синтез белков-антигенов другого вируса, в антиген-презентирующие клетки.

Апробация работы Материалы исследований по теме диссертации были представлены на российских и международных конференциях: VII Intern. Conf.Comparative and applied virology"(Montreal,Quebec, Canada, 1994);

«II Intern.congress of immunoreabilitation» (Antalia, Turkey, 1996);

First Jeint Meeting of the"ICS and ISICR" (Geneva, Switzerland, 1996);

«Современная вакцинология» (Пермь, 1998);

международные конференции СПИД, рак и родственные проблемы (Санкт Петербург, 1999-2002г.);

«Молекулярная медицина» (Пущино, 2001);

"DNA vaccines" (Edinburg, UK, 2002);

International Congress of Virology1996, 2002;

«Молекулярная медицина и биобезопасность» (Москва, 2004);

"Вакцинология 2006", Москва;

«International symp. on HIV and emerging infectious diseases»

(Toulon, Franse, 2008);

«Междунар. конгресс по реабилитации в медицине и иммунореабилитации» (Тель-Авив, Израиль, 2009) и на других конференциях.

Работа выполнена во ФГУН ГНЦ ВБ "Вектор" Роспотребнадзора в рамках научных тем организации и по грантам государственных научно-технических программ "Новейшие методы биоинженерии", "Исследования и разработки по приоритетным направлениям развития науки и техники, подраздел: «Защита от патогенов», по Федеральной Государственной программе Вакцины нового поколения и диагностические системы будущего, гранту РФФИ № 00-04 49508 «Теоретическое и экспериментальное моделирование искусственных иммуногенов - кандидатов в вакцины», грантам МНТЦ № 1465, 1685, 2464, 2547, 2641, 2914.

По теме диссертации опубликовано 83 научных статьи, в том числе статей в ведущих научных журналах, рекомендованных ВАК Минобразования и науки Российской Федерации, 90 тезисов докладов Получено 11 патентов Российской Федерации на изобретения, три из них удостоены дипломов в номинации «100 лучших изобретений России»..

Структура и объем работы Диссертация состоит из 7 разделов: Введение, Обзор литературы, Материалы и методы, Результаты и обсуждение, Заключение, Выводы и Список литературы. Работа изложена на 312 страницах машинописного текста, содержит 66 рисунков, 28 таблиц. Библиография представлена источниками отечественных и зарубежных авторов.

Личный вклад автора Участие автора при проведении исследований по диссертации заключается в личном участии практически во всех теоретических и экспериментальных работах по получению иммунобиологических препаратов на основе рекомбинантных молекул. Основные разделы представленного исследования выполнены автором самостоятельно, насколько это возможно при выполнении докторских диссертационных работ.

ОСНОВНОЕ СОДЕРЖАНИЕ РАБОТЫ

Создание препаратов рекомбинантных белков медицинского назначения.

Изучение стабильности штаммов-продуцентов рекомбинантных белков и разработка способов повышения их продуктивности. В работе использовали плазмиды с встроенными генами цитокинов и содержащие ген bla (маркер устойчивости к ампициллину, АрR). В качестве реципиентного штамма для трансформации использовали клетки E.coli SG 200-50, дефектные по La-протеазе и потому удобные для наработки рекомбинантных белков.

В ходе экспериментов по выращиванию трансформированных клеток выяснили, что снижение уровня биосинтеза целевых белков в биомассах является следствием накопления в культурах в процессе их культивирования популяции бесплазмидных клеток. Этот процесс объясняется тем, что выделяемая трансформированными клетками -лактамаза инактивирует ампициллин в окружающей среде и клетки, утратившие плазмиду, получают возможность роста.

Ампициллин может оказывать не только ингибирующее действие на рост интактных клеток, но и вызывать их лизис. Он подавляет активность одного или нескольких ферментов синтеза пептидогликана (пенициллинсвязывающих белков), что приводит к подавлению роста бактерий и запуску цепочки последовательных биохимических событий, результатом которых является осмотический лизис клетки.

Для определения концентраций ампициллина, при которых происходит гибель бесплазмидных (АpS) клеток, а плазмидсодержащие (ApR) сохраняют жизнеспособность. был проведен ряд экспериментов: 1) инкубация суспензий клеток с различными концентрациями ампициллина с последующим высевом на агаризованную среду без антибиотика;

2) анализ культуральной жидкости (без клеток) на содержание в ней клеточных белков при инкубации суспензии клеток с антибиотиком. Результаты представлены в таблице 1.

Таблица 1.

Рост клеток на агаризованной среде без антибиотика после их инкубации в среде с различными концентрациями ампициллина.

Концентрация Реципиентные клетки Трансформированные клетки Трансформированные клетки E.coli SG 200- антибиотика, E.coli SG 200-50/pLT 21 E.coli SG 200-50/pGGF мкг/мл. (продуцент TNF-) (продуцент G-CSF) Время инкубации 1ч 3ч 1ч 3ч 1ч 3ч 0 +++ +++ +++ +++ +++ +++ 50 ++ + +++ +++ +++ +++ 100 + + +++ +++ +++ +++ 200 + + +++ +++ +++ +++ 400 + - +++ +++ +++ ++ 600 - - ++ + + + 800 - - + - - 1200 - - - - - +++ рост газоном, ++ отдельные колонии, + единичные колонии.

Как видно из таблицы, после инкубации реципиентных клеток (АрS) в среде с антибиотиком до 400 мкг/мл в течение 1 ч отдельные клетки сохраняют способность к росту при высеве их на среду без селективного давления, тогда как после 3-х часовой инкубации их роста мы не наблюдали. В то же время после инкубации трансформированных клеток (АрR) в тех же условиях их способность к росту практически не изменялась, начиная снижаться при концентрациях ампициллина выше 600 мкг/мл.

На электрофореграмме было видно, что белки реципиентных клеток в культуральной жидкости в значительных количествах начинают обнаруживаться при концентрациях ампициллина выше 400 мкг/мл, т.е.

происходит лизис бесплазмидных клеток.

Из этих экспериментов можно сделать вывод, что обработка суспензии клеток рекомбинантного штамма-продуцента ампициллином в концентрациях 400-500 мкг/мл в течение 2-3 ч может повышать процентное содержание плазмидсодержащих (ApR) клеток в культуре.

При исследовании влияния дробного добавления ампициллина в среду (до 50-100 мкг/мл через каждые 2-3 ч) в процессе ферментации были получены результаты, свидетельствующие о том, что процент плазмидсодержащих клеток в культурах наблюдался выше и выше продуктивность биомассы по целевым белкам.

В итоге, для повышения содержания целевого продукта в биомассе мы использовали:

а) для получения посевного материала - отбор высокопродуктивных клонов трансформированных клеток;

б) для засева – посевной материал, состоящий из культуры клеток, находящихся в логарифмической фазе роста, дополнительно обработанный ампициллином в концентрации 400-500 мкг/мл в течение 2-3 ч;

в) дробное добавление антибиотика в культуральную среду в процессе ферментации;

г) сбор биомассы, когда культура находится в последней трети логарифмической фазы роста.

Этот комплекс методов позволил не только повысить процентное содержание целевых белков в биомассах, но и сделать процесс их биосинтеза более стабильным и управляемым. При стандартном способе культивирования содержание целевых белков в биомассах клеток варьировало от опыта к опыту и составляло от суммы клеточных белков в %: для TNF- - 10 15 %, TNF- - 2-4 %, G-CSF – 2,0-6,0 %, GM-CSF – 2-5 %. При культивировании с использованием разработанного комплекса методов, целевые белки в биомассах всегда присутствовали в количествах не ниже 10 % от суммы клеточ ных белков: TNF- - 15 –25 %, TNF- - 12-16 %, G-CSF – 10-12 %, GM-CSF – %.

Получение рекомбинантных белков, предназначенных для использования в качестве противовирусных препаратов, иммуномодуляторов и адъювантов.

Получение препаратов интерферона- и его антагонистов, разработка технологий их очистки. Иммунный интерферон (IFN-) используется в качестве компонента лекарственных средств, предназначенных для лечения ряда вирусных, онкологических и аутоиммунных заболеваний.

При разработке схемы очистки IFN- использовали комбинацию хроматографий на катионообменном сорбенте. Это обусловлено тем, что значение изоэлектрической точки этого белка выше значения 8,5 и на анионообменных сорбентах его сорбция затруднена. Согласно работе (Yip Y.K., 1981) изоэлектрическая точка IFN- соответствует значению 8,6-8,7.

Для получения телец включения, содержащих IFN-, суспензию клеток в буфере А (20 мМ Трис-HCl. рН 8,3) подвергали обработке ультразвуком.

Тельца включения осаждали центрифугированием и дважды промывали буфером А, содержащим 1 мМ ZnCl2, 0,1 мМ CuCl2 и 0,5 мМ PMSF. Их дополнительно промывали 4 М раствором мочевины и проводили экстракцию IFN- 5 М раствором Gnd-Cl в буфере А (25 мМ Трис-НС1, рН 8,3).

Практически весь белок IFN- при этом находился в растворе гуанидина.

Для проведения хроматографической очистки Gnd-Cl удаляли диализом раствора белка против буфера А, содержащего 8 М мочевину, 0,1% Тритон Х 100 и 0,1% ПЭГ 6000.

Для элюции IFN- с колонки (КM-сефароза) был разработан состав градиента: 25 мМ Трис-НС1, рН 8,3 – 25 мМ ацетат натрия, рН 5,8 с 0,8 М NaCl.

Оба раствора содержали мочевину. Элюция целевого белка наблюдалась при концентрации NaCl в растворе 0,4±0,05 М. Целевой белок смывался с колонки лишь с незначительными примесями клеточных белков в фракциях, соответствующих началу его элюции. Изменение значения рН в ходе элюции способствовало "растягиванию" процесса десорбции белков, тем самым, позволяя "раздвинуть" пики выходов целевого белка и примесных, и собрать более чистую фракцию препарата. Раствор белка разбавляли в три раза буфером (рН 5,8), содержащим 8 М мочевину, и для доочистки IFN проводили рехроматографию на КМ-сефарозе. Для элюции интерферона с колонки при второй хроматографии использовали состав градиента: 25 мМ ацетат натрия, рН 5,8 – 25 мМ Трис-НС1, рН 8,0 с 1 М NaCl. При этом целевой белок элюировался при концентрации NaCl 0,5±0,05 М. Для ренатурации IFN раствор разбавляли в два раза буфером А и перемешивали в течение 3 ч при температуре 40С. Далее раствор белка вновь разбавляли в два раза и инкубировали при перемешивании в течение 5 ч. Полученный раствор белка диализовали против буфера (10 мМ трис-ацетат, рН 6,0 и 0,9% NaCl). Чистота IFN- была не менее 98%, удельная активность (5-10) х 107 МЕ/мг, выход 0,9-1, мг из 1 г влажных клеток.

При выборе состава лекарственной формы в качестве стабилизаторов были апробированы различные вещества: моно- и полисахариды, аминокислоты, рибонуклеиновые кислоты, гепарин и пр. Для этого в раствор с препаратом интерферона вносили исследуемое вещество (в различных концентрациях) и затем – трипсин (10 мкг/мл). Через промежутки времени отбирали аликвоты раствора, белки осаждали спиртом и анализировали продукты деградации электрофорезом в 15%-ом ПААГ. О степени защиты стабилизаторов судили по длительности сохранения исходной молекулы IFN-.

В итоге был выбран следующий состав (мкг/дозу):

Высокоочищенный интерферон-гамма 10- Аспарагиновая кислота Маннит (или реополиглюкин) 5% от объема Буфер: трис-ацетат, рН 6,0 10 мМ NaCl 0,9% В ГНЦ ВБ «Вектор» были проведены работы по получению аналогов IFN с улучшенными свойствами. Один из созданных аналогов имел укороченный на 10 аминокислот С-конец молекулы и 3 аминокислотные замены аргинин129 лизин130-аргинин131 на глицин129-серин130-аланин131. Данный белок получил название «10» или «дельтаферон». Было показано, что подобные изменения в белковой молекуле привели к 20 кратной потере антивирусной активности по сравнению с полноразмерным IFN-, но не сказались на его иммуномодулирующих свойствах. Среди отличительных признаков дельтаферона от IFN- наиболее интересными является его устойчивость к протеолитическим ферментам и микробный биосинтез в растворимой форме.

После разрушения клеток и центрифугирования суспензии дельтаферон оставался в надосадочной жидкости. Для очистки белка также использовали ионообменную хроматографию на КM-сефарозе. Для элюции дельтаферона с колонки был использован состав градиента: 50 мМ Трис, рН 8,0 – 50 мМ HEPES, рН 6,5 с 0,5 М NaCl. На этой стадии удалось достигнуть 80% чистоты целевого белка.

Для доочистки и концентрирования дельтаферона проводили рехроматографию на КM-сефарозе. Наносимый на колонку раствор белка разбавляли в два раза буфером (рН 6,3). Элюцию белка осуществляли в градиентах NaCl от 0 до 1,0 М и значении рН от 6,3 до 8,3. Дельтаферон элюировался с сорбента в виде узкого пика.

При использовании разработанного способа удается получить из 1 г влажных клеток около 6 мг белка с чистотой не менее 98%. Противовирусная активность препарата дельтаферона составила не менее 106 МЕ./мг белка.

Средние значения результатов анализов 5 серий показали, что препараты интерферона по чистоте (по содержанию примесей клеточных белков, ДНК и липополисахаридов) соответствуют допустимым нормам для иммунобиологических препаратов (МУК 4.1/4.2.588-96).

Таким образом, были разработаны эффективные технологии получения высокоочищенных препаратов интерферона-. Выход дельтаферона на 1 г клеточной массы в 4-6 раз выше, чем исходного препарата - интерферона--, от 6 мг по сравнению с 0,9-1,5 мг из 1 г клеток.

Сохранение у дельтаферона характерной для исходного IFN антипролиферативной активности наблюдали на мононуклеарных клетках человека, где было показано, что белки в равной степени снижали пролиферацию клеток. На экспериментальной модели адъювантного артрита мышей, вызванного внутрикожным введением полного адъюванта Фрейнда (ПАФ), было установлено, что дельтаферон по уровню противовоспалительной активности существенно не отличался от IFN-.

Разработка способа очистки антагонистов (аналогов рецепторов) IFN-.

Антагонисты IFN- применяются в клинической практике для лечения аутоиммунных и воспалительных заболеваний человека, при пересадках органов и тканей. Для получения антагонистов IFN- (аналогов рецепторов) использовали эукариотические векторы экспрессии с встроенными в них генами из вирусов оспы (штаммы Zaire, India), созданные в ГНЦ ВБ Вектор.

Наработку белков осуществляли в бакуловирусной системе.

Для хроматографической очистки был синтезирован аффинный сорбент на основе высокоочищенного препарата IFN-. Полученный сорбент содержал 0,8 0,2 мг IFN-/мл геля сефарозы CL-4В. Колонка выдерживала более десяти хроматографических циклов очистки без утраты сорбционных свойств.

При очистке для уменьшения объема раствора белки из культуральной жидкости предварительно осаждали сульфатом аммония. После растворения осадка и диализа полученный раствор наносили на аффинную колонку со скоростью протока жидкости 1 объем колонки в час. Элюцию проводили 0,2 М раствором глицин-НС1, рН 2,5, нейтрализуя раствор в собираемых фракциях М раствором Трис-НС1, рН 9,0. Очищенные белки диализовали против физиологического раствора.

Препараты гомогенны и могут быть использованы для применения в медицинской практике, в качестве компонентов тест-систем, а также для изучения аналогов рецепторов вирусов оспы в структурном и эволюционном аспектах.

Получение препаратов факторов некроза опухолей и их антагонистов, разработка технологий их очистки. Исследовали зависимость перехода белков TNF из клеток в раствор от степени разрушения клеток. Установили, что при снижении оптической плотности Д550 суспензии клеток (при обработке ее ультразвуком) до 75-80% от исходной, основная часть целевых белков, после центрифугирования, находилась в растворе. Более полное разрушение клеток приводило к выходу в раствор балластных белков и усложнению процесса очистки. После разрушения клеток водный экстракт использовали для извлечения и очистки из него целевых белков.

В ходе экспериментов по разработке схемы очистки факторов некроза опухолей были апробированы хроматографии на различных сорбентах. В результате проведенных исследований была разработана следующая схема:

Экстракт Хроматография Хроматография Диализ Рехроматография клеток на ДЕАЕ-ц на ГАПе на ДЕАЕ-ц При выборе значений рН для проведения хроматографий, провели серию экспериментов и выяснили, что при хроматографической очистке TNF- на ДЕАЕ-целлюлозе при рН выше 9,2 и ниже 8,8 увеличивается процентное содержание загрязняющих белков в целевой фракции. Степень очистки при этом снижается с 2 до 1,8 при рН 9,6 и до 1,6 при рН 8,4.

Установили, что при хроматографической очистке TNF- на гидроксилапатите (в качестве второй стадии после хроматографии на ДЕАЕ целлюлозе) при значениях рН выше 6,8 и ниже 6,6 снижается значение степени очистки.

В результате, для проведения хроматографии на ДЕАЕ-целлюлозе, было выбрано значение рН 8,9, а для проведения хроматографии на гидроксилапатите значение рН 6,8.

Таким образом, при использовании "динамического" способа выбора оптимальных условий проведения хроматографических стадий разработана схема очистки TNF-, позволяющая получать высокоочищенные препараты целевого белка из биомасс с его различным содержанием. Пример очистки представлен на рис. 1.

Рис. 1. Электрофореграмма фракций белков в процессе очистки TNF- в 15%-ном ПААГ в денатурирующих условиях. Дорожки:

1 – клеточный экстракт;





2 – фракция после ДЕАЕ-целлюлозы;

3 – фракция после гидроксилапатита;

4,5 – конечный продукт (10 и 40 мкг, соответственно).

М - белки-маркеры молекулярных масс (45000 Д, 29000 Д, 17800 Д, 14400 Д).

(Стрелкой отмечена подвижность TNF- в геле).

При очистке аналога TNF- R31Q по той же схеме было установлено, что он полностью сорбировался на колонке с ДЕАЕ-целлюлозой при значении рН 8,3. Элюцию белков проводили линейным градиентом NaCl от 0 до 0,15 М при значениях рН 8,3 в буферах. Целевой белок элюировался с колонки при концентрации NaCl 0,08 - 0,1 М. При этом достигалась степень очистки в 1,6 1,7 раза с выходом целевого продукта около 75%.

Для проведения второй хроматографии, на гидроксилапатите, раствор белков титровали до значения рН 6,8 перед нанесением на сорбент. Элюцию белков проводили промыванием колонки раствором калий-фосфата с повышающейся концентрацией от 0 до 0,4 М. TNF- R31Q элюировался при концентрации калий-фосфата 0,2-0,33 М.

Концентрирование и дополнительную очистку препарата проводили при помощи рехроматографии на ДЕАЕ-целлюлозе. Перед этим раствор TNF R31Q диализовали против 10 мМ Трис-HCl-буфера, рН 8,3. При рехроматографии элюцию белков проводили линейным градиентом калий фосфата (рН 8,3) от 0 до 0,15 М. TNF- R31Q элюировался при концентрации соли 0,07 - 0,1 М в виде узкого пика и имел чистоту не ниже 95%.

Предложенная и апробированная схема очистки факторов некроза опухолей проще, чем известные (Schoenfeld H.J. et al., 1991;

Денисов A.A. и др., 1995;

Тихонов П.В. и др., 1996), более технологична и сам процесс легко масштабируется. Результаты анализов серий препаратов показали, что препараты факторов некроза опухолей по чистоте (по содержанию примесей клеточных белков, ДНК и липополисахаридов) соответствуют допустимым нормам для иммунобиологических препаратов (МУК 4.1/4.2.588-96).

Полученные препараты факторов некроза опухолей были охарактеризованы по своим физико-химическим характеристикам и биологическому действию. Проведен анализ аминокислотного состава и показано, что он соответствует ожидаемому. Определены молекулярные массы белков с помощью электрофореза в ПААГ в денатурирующих условиях: для аналога TNF- - 17300 200 Д, для TNF- - 16200 200 Д.

При изучении стабильности аналога TNF- R31Q выяснили, что его молекулы по сравнению с исходным белком TNF- более устойчивы к протеолизу (0,1%-ный раствор трипсина, 300С). Так, в течение 60 мин исходный рекомбинантный белок гидролизовался на 50%, тогда как мутантный сохранялся практически полностью (87%).

Специфическая цитотоксическая активность TNF- и его мутантного аналога TNF- R31Q в отношении мышиных фибробластов L 929 в экспериментах составляла около (4 - 5) 107 Е/мг и (2 - 4) 107 Е/мг белка соответственно. Удельная биологическая активность TNF-, определенная в том же тесте, составляла около (4 - 8) 107 Е/мг белка.

Разработка способа очистки антагонистов фактора некроза опухолей.

Антитела к TNF, рецепторы и их аналоги применяются как терапевтические препараты в клинической практике и как компоненты при создании тест систем для определения содержания TNF в биологических жидкостях. В своих исследованиях мы ставили цель разработать универсальный способ очистки антагонистов TNF.

Для очистки антагонистов TNF был синтезирован аффинный сорбент на основе высокоочищенного препарата TNF. Полученный сорбент содержал 0, 0,2 мг TNF/мл геля сефарозы CL-4В. Колонка выдерживала более десяти хроматографических циклов очистки без утраты сорбционных свойств.

После хроматографии моноклональных антител (производства ПО Контур, С.-Петербург) на колонке титр антител в пересчете на объем не изменился, но по содержанию белка наблюдалась очистка в четыре раза.

Целевая фракция по результатам электрофореза в ПААГ содержала иммуноглобулины и была гомогенной.

При очистке поликлональных антител к TNF из сыворотки кроликов, так же как и в случае с мАТ, целевая фракция содержала иммуноглобулины и по данным электрофореза в ПААГ была гомогенной. Титр антител составлял в разных опытах от 1: 4000 до 1: 20000.

Для получения аналогов рецепторов использовали эукариотические векторы экспрессии с встроенными в них генами вирусов натуральной оспы штаммов Индия и Гарсия, вируса оспы обезьян штамма Заир и вируса оспы коров штамма Гришак, созданные в ГНЦ ВБ Вектор. Наработка белков осуществлялась в бакуловирусной системе. Целевые белки выделяли из культуральной жидкости. Для уменьшения объема раствора белки предварительно осаждали сульфатом аммония. После растворения осадка и диализа раствор наносили на аффинную колонку со скоростью протока жидкости 1 объем колонки в час. Элюцию целевых белков проводили 0,2 М раствором глицин-НС1, рН 2,5, нейтрализуя раствор в собираемых фракциях 1 М раствором Трис-НС1, рН 9,0. Очищенные белки диализовали против физиологического раствора.

Выход гомогенного белка с 100 мл культуральной жидкости составлял 0, 0,20 мг и был практически одинаков для всех четырех, используемых в работе, аналогов рецептора.

Таким образом, разработан универсальный способ получения антагонистов TNF. Препараты гомогенны, могут быть использованы для применения в медицинской практике, в качестве компонентов тест-систем, а также для изучения аналогов рецепторов вирусов в структурном и эволюционном аспектах.

Получение рекомбинантных белков – антигенов для создания вакцинных препаратов против вируса иммунодефицита (ВИЧ) Получение белка-антигена TBI (кандидата в вакцины против ВИЧ-I).

Один из перспективных подходов к созданию нового поколения надежных и безопасных вакцин основан на идентификации Т- и В-клеточных эпитопов внутри белковых антигенов ВИЧ-1 и конструировании на их основе полиэпитопных вакцин.

Одним из таких иммуногенов является искусственный белок, получивший название TBI (T and B cell epitopes containing immunogen). Этот ВИЧ-иммуноген представляет собой четырех--спиральный белок, содержащий четыре Т-клеточных эпитопа и пять В-клеточных нейтрализующих эпитопов из белков Env и Gag ВИЧ-1.

Искусственный белок TBI не удалось синтезировать в чистом виде в клетках E. coli. Для доcтижения приемлемой продукции к белку TBI были присоединены последовательности, соответствующие либо фрагменту белка recA (22 а.о.), либо ферменту глутатион-S-трансферазы. Ген TBI был клонирован в составе плазмид RSIII и pGEX-2T-TBI соответственно.

При работе с антигеном TBI-recA было отмечено, что при биосинтезе белок накапливался в трансформированных клетках E.coli JM 103/pTBI в основном в нерастворимой форме.

Выделение белка проводили из телец включения. Для этого суспензию клеток в буфере А (20 мМ Трис-HCl. рН 8,3) подвергали обработке ультразвуком. Тельца включения осаждали центрифугированием и дважды промывали буфером. Было установлено, что белок TBI-recA растворяется из телец включения практически полностью при концентрации мочевины в растворе 6 М, при этом экстракт минимально загрязнен примесными белками (рис. 2).

Рис. 2. Электрофореграмма фракций клеток E.coli JM 103/pTBI в 15%-ном ПААГ. Дорожки:

1 – водный экстракт клеток буферным раствором (супернатант);

2 – экстракт телец включения 6 М раствором мочевины;

3 – конечный осадок после извлечения целевого белка;

TBI 4 – лизоцим (14400Д).

Для освобождения от части балластных белков и примесей нуклеиновых кислот проводили хроматографическое фракционирование экстракта из телец включений на колонке с ДЕАЕ-целлюлозой ДЕ-52 в присутствии мочевины.

Элюция целевого белка наблюдалась при концентрации NaCl 0,1±0,03 М. Для ренатурации белка раствор разбавляли в два раза буфером А и перемешивали в течение 3 ч при температуре 40С. Далее раствор белков вновь разбавляли в два раза и инкубировали при перемешивании в течение 5 ч. Затем полученный раствор белков диализовали против буфера А в течение 20 ч при температуре 40С.

Для доочистки и концентрирования ренатурированного белка TBI-recA проводили рехроматографию на колонке с ДЕАЕ-целлюлозой. При этом целевой белок элюировался при концентрации NaCl 0,15-0,2 М. Выход целевого продукта (белка TBI-recA) в процессе очистки составлял около 40% от его исходного содержания, чистота белка - не менее 95%.

Для подтверждения аминокислотной последовательности белка recA-TBI была проведена его масс-спектрометрия. (Анализ выполнен М. Серебряковой, Институт биоорганической химии им. М. М. Шемякина и Ю. А. Овчинникова, г. Москва).

Ниже приведена аминокислотная последовательность белка recA-TBI, на сновании данных масс-спектрометрии:

AIDENKQKALGSDIPGALDLQTHGIRPVVSTQLGSEQMHEDIISLWDQSLKPGIQRGP GRAFGSKQIINMWQEVGKAMYAPGAPEGIEEEGGERDRGSDRVIEVVQGAYRAI RGTQGVGGPGHKARGSEPFRDYVDRFYKTLRGPIEIKDTKEALDKIEEEQNSG Аминокислотная последовательность белка recA-TBI соответствовала заявленной нуклеотидной и аминокислотной последовательностям.

О степени чистоты полученного препарата белка косвенно свидетельствует тот факт, что он был кристаллизован. Впервые для белка с гипотетически заданной на основе элементов функциональных белков третичной структурой выращены кристаллы, дифрагирующие рентгеновские лучи.

Гибридный белок глутатион-S-трансфераза-TBI (TBI-gst) при биосинтезе также накапливался в клетках в виде телец включения. Для его очистки клетки разрушали ультразвуком и тельца включения дважды промывали буферным раствором. Гибридный белок растворяли в 6 М растворе мочевины. Удаляли осадок центрифугированием и проводили ренатурацию, последовательно разбавляя раствор и инкубируя при концентрациях мочевины 3 М (5 ч) и 1, М (16 ч). После этого проводили диализ против буфера, не содержащего денатурирующего агента. Для очистки использовали аффинную хроматографию на глутатион-сефарозе.

Анализ белка TBI-gst представлен на рис.3. Антигенные свойства белка оценивали с помощью иммуноблоттинга. Было показано, что искусственный белок TBI-gst «узнается» сывороткой ВИЧ-инфицированного человека (рис.

3Б). Сыворотки кроликов, иммунизированных очищенным белком TBI-gst, «узнавали» нативные белки ВИЧ-1. При этом IgG сывороток кроликов связывались с белками gp160, gp120, gp41, p24 и p17 ВИЧ-1.

Получение искусственного антигена ВИЧ-1 – полиэпитопного белка TCI. В ГНЦ ВБ «Вектор» был рассчитан и синтезирован ген белка TCI длиной пар нуклеотидов, который кодирует целевой белок, состоящий из аминокислотных остатков и содержащий около 80 эпитопов основных вирусных белков-антигенов Env, Gag, Pol и Nef (как CD8+ CTL, так и CD4+ Th). Рассчеты проведены С.И. Бажаном (ГНЦ ВБ «Вектор»). Ген белка TCI был клонирован в клетках Е. coli в составе экспрессионной векторной плазмиды pGEX-2T. При культивировании рекомбинантных клеток гибридный белок TСI-gst синтезировался в водорастворимой форме.

Рис. 3. А. Электрофореграмма фракций белков в 12,5% ПААГ. Дорожки:

1) маркеры молекулярных масс;

2) лизат клеток E. coli, содержащих плазмиду pGEX-TBI;

3) очищенный белок TBI-gst;

4) лизат клеток E. coli, не содержащих плазмиду.

Б. Иммуноблоттинг с положительной по.

ВИЧ-I сывороткой человека: 1) лизат клеток E. coli, содержащих плазмиду pGEX-TBI;

2) лизат клеток E. coli, не содержащих плазмиду.

Для выделения гибридного белка TСI-глутатион-S-трансфераза (TСI-gst) клетки разрушали ультразвуком. Очистку белка TСI-gst из раствора проводили при помощи аффинной хроматографии на колонке с глутатион сефарозой. Полученный препарат белка был свободен от примесей клеточных белков и содержал лишь небольшую примесь белка глутатион-S трансферазы, которую отделяли гель-фильтрацией.

Присутствие эпитопов белков ВИЧ-1 в структуре синтезированного белка было подтверждено с помощью ИФА и иммуноблот-гибридизации с использованием панелей ВИЧ-1-позитивных сывороток и моноклональных антител к вирусному белку р24.

Создание молекулярных конструкций вирусоподобных нанобиочастиц для получения на их основе лечебных и профилактических препаратов Выбор и исследование полинуклеотидного комплекса для создания молекулярных конструкций вирусоподобных нанобиочастиц. Для вакцинации людей перспективным представляется создание такой конструкции вакцины, которая имела бы и антигенные свойства, и стимулятор иммунного ответа, и в то же время имела молекулярную массу, сравнимую с мол. массами вирусов, т.е. являлась бы полным антигеном. В качестве стимуляторов иммунного ответа применяются полисахариды, липидные (в том числе липосомы) и полинуклеотидные комплексы (двуспиральная РНК, фрагментированная ДНК) и др.

При создании молекулярной конструкции вакцинных препаратов мы ориентировались на модель строения вирусов. На роль полинуклеотидного комплекса необходимо было выбрать нуклеиновую кислоту, не содержащую гены патогенности и в то же время, стимулирующую иммунный ответ.

В качестве одного из вариантов центрального ядра вирусоподобной конструкции (ВПЧ) использовали двуспиральную РНК дрожжей штамма Saccharomyces cerevisiae M437 Y116 (L- форма - около 4500 п.н. и M-форма - около 1800 п.н. и, соответственно, мол. массы около 3000000 Д и 1200000 Д). Выбор был обусловлен тем, что двуспиральная РНК, получаемая из дрожжей штамма Saccharomyces cerevisiae M437 Y116, является основным компонентом лекарственного препарата "Ридостин", который разрешен к применению в медицинской практике в качестве стимулятора неспецифической резистентности (Машковский М.Д., 2001).

Очищенный препарат двуспиральной РНК имел чистоту около 95% и соотношение L- и М-форм 1 : 1 (рис. 4). При токсикологических исследованиях молекулярных конструкций – препаратов ВПЧ, созданных на основе дсРНК Sac. сerevisiae было показано, что ни в одном из используемых тестов не обнаружено более выраженного негативного эффекта ВПЧ, по сравнению с его компонентом, препаратом дсРНК Повышение иммуногенности коротких пептидов с помощью вирусоподобных нанобиочастиц. Одним из перспективных направлений иммунопрофилактики является разработка вакцин на основе синтетических пептидов. На основе фрагмента белка HLDF (фактор дифференцировки) шестичленного пептида (HLDF6 = Thr-Gly-Glu-Asn-His-Arg) предложен способ представления синтетических пептидов клеткам иммунной системы путм создания молекулярной конструкции.

Конструкция представляет собой вирусоподобную частицу, в центральной части которой содержится двуспиральная РНК из дрожжей Saccharomyces cerevisia, а на поверхности – пептиды HLDF6 в составе конъюгата с полианионом (декстран-спермидин). Вид полученных частиц схематично представлен на рис. 4А.

12 1 Рис. 4. Характеристики иммуногена А - схема конструкции иммуногена: 1- нуклеотидный материал (двуспиральная РНК);

2- конъюгат спермидин-полиглюкин-HLDF6.

Б - Электрофореграмма препаратов в 1%-ном геле агарозы. Дорожки:

1 – исходная дсРНК;

2 – помещенная в оболочку из конъюгата спермидин полиглюкин-HLDF6.

На электрофореграмме в агарозном геле (рис. 4Б) видно, что двуспиральная РНК (L и M формы), покрытая конъюгатом спермидин полиглюкин -HLDF6, имеет меньшую подвижность по сравнению с исходной РНК. Снижение электрофоретической подвижности РНК можно объяснить увеличением е молекулярной массы за счет образования комплекса с коньюгатом и частичной нейтрализацией в комплексе отрицательного заряда РНК положительно заряженным спермидином.

Соотношение компонентов в молекулярной конструкции было выбрано таким образом, чтобы на 1 молекулу дсРНК приходилось около 100 молекул конъюгата и соответственно, около 2000 молекул пептида HLDF6.

При иммунизации мышей линии BALB/c иммуноген вводили подкожно трехкратно с двухнедельными интервалами. Однократная доза иммунизации составляла 100 мкг (по пептиду) на животное. В качестве положительных контролей использовали неконъюгированный HLDF6 (100 мкг) и HLDF6 ( мкг) в ПАФ. Через десять дней после последней иммунизации проводили определение титров антител к пептиду HLDF6.

Специфические антитела в сыворотках мышей, иммунизированных молекулярной конструкцией, обнаруживались при использовании на подложке всех использованных антигенов (пептид HLDF6, его конъюгат с полиглюкином, а также полноразмерный белок HLDF). Положительный сигнал, достоверно превышающий фоновый, выявлялся при разведении сывороток от 1:320 до 1:1280. При использовании для иммунизации неконъюгированного HLDF6 титр в сыворотках не превышал 1:20 – 1:60. После иммунизации линейными пептидами в составе адъюванта Фрейнда регистрировали уровень специфичных IgG 1:640.

Таким образом, обладая значительной молекулярной массой и размерами, иммуногены индуцировали выраженный гуморальный иммунный ответ и не требовали использования адъювантов. Предложенный подход может быть использован при создании широкого спектра иммуногенов и вакцин на основе полипептидов.

Создание самособирающихся вирусоподобных нанобиочастиц вакцинных препаратов на основе принципов аффинного взаимодействия компонентов. В качестве модельных антигенов были выбраны гибридные белки, содержащие антигены ВИЧ-I: TBI-глутатион-S-трансфераза и gp41(607 620)--галактозидаза. Белок TBI-gst способен одной своей половиной молекулы аффинно соединяться с конъюгатом глутатион-полисахарид, а вторая половина (TBI) – экспонировала эпитопы HIV-I на поверхности конструкции.

Выбор антигена gp41(607-620) был сделан на основании того, что одна из главных иммуногенных областей оболочки ВИЧ-1 расположена в N-концевой части gp41 на участке env (590-620). Указанный фрагмент экспонирован на поверхности вирусной частицы в виде петли и формирует высокоиммуногенный участок, включающий несколько индивидуальных эпитопов.

В качестве полисахаридной матрицы использовали конъюгат полиглюкина со спермидином и глутатионом (или галактопиранозидом).

Положительно заряженный спермидин обеспечивал связывание конъюгата с полинуклеотидным комплексом (ионная связь), глутатион (или галактопиранозид) – аффинно сорбировал гибридный белок TBI-gst (или gp41(607-620)- -галактозидаза). Введение дсРНК - индуктора синтеза интерферонов и повышение размеров иммуногена по сравнению с субъединичным белком предполагало повышение напряженности иммунного ответа.

В качестве центрального ядра конструкции использовали двуспиральную РНК дрожжей штамма Saccharomyces cerevisiae. Схематично вид молекулярной конструкции в виде вирусоподобных частиц, в центре которых находится полинуклеотидный комплекс, окруженный полисахаридной матрицей, а на поверхности экспонирована антигенная детерминанта представлен на рис. 5А.

А Б Рис. 5. А. Схема молекулярной конструкции кандидатных вакцин.

1 – нуклеотидный материал (двуспиральная РНК или плазмидная ДНК);

2 - конъюгат: спермидин-полиглюкин-субстрат для фермента (глутатион, галактопиранозид и т.д.);

3- гибридный белок, содержащий антиген и фермент (глутатион-s-трансфераза, галактозидаза и т.д.).

Б. Изображение вирусоподобных частиц, полученное методом электронной микроскопии. Увеличение х 88 000.

Для получения полисахаридной оболочки полиглюкин (60000Д) активировали периодатом натрия и затем отделяли гель-фильтрацией. После этого в раствор активированного полиглюкина вносили глутатион и спермидин. После инкубации и обработки боргидридом натрия, непрореагировавшие компоненты удаляли гель-фильтрацией. Исходные компоненты вносились в таких соотношениях, чтобы получаемый конъюгат содержал на 1 молекулу полиглюкина по 9 молекул глутатиона и спермидина.

Для сборки конструкции к раствору, содержащему нуклеотидный материал в изотоноческом растворе, добавляли полисахаридную вставку, смесь инкубировали и образовавшийся комплекс отделяли гель-фильтрацией на сефарозе CL-6B. После этого добавляли гибридный белок в изотоническом.

растворе и также инкубировали в течение 2 ч. Полученную конструкцию отделяли от несвязавшихся компонентов гель-фильтрацией на сефарозе.

При подсчете материального баланса по компонентам, вносимым в реакции синтеза, было определено, что конечная конструкция имела соотношение: на 1 молекулу нуклеотидного материала – в среднем 48 молекул полисахаридной вставки и 100 молекул гибридного белка. При гель хроматографии на колонке с сефарозой CL-6B собранная конструкция элюировалась в свободном объеме ( 4 МДа).

Рассчитанные теоретически диаметры полученных частиц составляли:

для конструкции с L-формой дс РНК в центре около 28 нм, с М-формой – нм. На практике, по данным электронной микроскопии, препарат содержал шарообразные частицы, имеющие в основном диаметр от 10 до 25 нм (рис. 5Б).

Среди частиц встречались также более крупные, диаметр которых достигал - 100 нм. Полученная молекулярная конструкция по своим размерам сравнима с величиной таких вирусов как вирусы полиомиелита и полиомы, и приближается к размерам вируса ВИЧ.

На электрофореграмме в агарозном геле (рис. 6) видно, что двуспиральная РНК (L и M формы), покрытая конъюгатом (полиглюкин спермидин), имеет меньшую подвижность. Это можно объяснить увеличением молекулярной массы и тем, что положительно заряженный спермидин частично нейтрализует в комплексе отрицательный заряд РНК. При добавлении гибридного белка образуются частицы (молекулярные конструкции), которые имеют еще меньшую подвижность в геле агарозы, на уровне фрагментов ДНК с молекулярной массой около 10-12 МДа.

1 2М Рис. 6. Электрофореграмма препаратов в 1%-ном геле агарозы, дорожки:

1 – исходная двуспиральная РНК;

2 – помещенная в оболочку из конъюгата спермидин полиглюкин-глутатион;

3 - помещенная в оболочку из конъюгата и добавлен антиген;

М – маркеры мол.массы (гидролизат ДНК фага рестриктазой EcoRI).

Для проверки полноты упаковки нуклеотидного материала в собранной конструкции проводили ее обработку РНКазой (10 мкг/мл). Опыт показал, что если для исходной дсРНК полная деградация наблюдалась уже через 30 мин инкубации, то в собранной конструкции нуклеотидный материал сохранялся интактным в течение суток.

При иммунизации мышей линии BALB/c животным вводили внутримышечно трехкратно с интервалом через две недели по 45 мкг (по белку) собранной конструкции. В качестве положительного контроля использовали субъединичный белок TBI-gst (80 мкг на мышь). Накопление антител в сыворотке мышей, иммунизированных субъединичным белком TBI gst и этим же белком в составе частиц, представлено на рис. 7.

Как видно на рисунке 7, вирусоподобные частицы индуцируют более высокий титр антител, по сравнению с титром, индуцируемым субъединичным белком TBI-gst, несмотря на то, что количество вводимого животным белка TBI-gst в составе частиц было в два раза меньше.

Вирусоподобные частицы вызывали пролонгацию иммунного ответа, выступая в качестве своеобразного депо антигенов инфекционного агента.

Способность белка TBI-gst индуцировать специфический Т-клеточный ответ оценивали в реакции бласт-трансформации. Результаты теста свидетельствовали о том, что иммунизация субъединичным белком TBI-gst и этим же белком в составе конструкции ВПЧ-TBI вызывала формирование клонов клеток памяти. Индекс стимуляции клеток in vitro специфическими белками ВИЧ-1 достоверно увеличивался после введения экспериментальных вакцинных препаратов. Максимальные значения регистрировались на 48 и сутки в группах животных, иммунизированных TBI-gst +ПАФ и ВПЧ-TBI соответственно. Причем данные теста практически не отличались при введении белка TBI как с адъювантом Фрейнда, так и в составе вирусоподобных частиц.

- lg титр 1 2 3 4 5 6 недели после начала иммунизации Рис. 7. Динамика изменения титра антител к белку TBI в сыворотках животных, иммунизированных субъединичным белком TBI-gst (80 мкг на мышь) (темные столбцы) и белком TBI-gst в составе вирусоподобных частиц (45 мкг по белку) (светлые столбцы). Контрольные животные (серые столбцы). В каждом опыте использовали сыворотки от пяти животных.

Таким образом, при использовании ВПЧ в качестве системы доставки рекомбинантного белка TBI-gst, показатели гуморального и клеточного иммунного ответа практически не отличались от таковых при введении белка с адъювантом Фрейнда, применение которого для человека запрещено.

Сыворотки иммунизированных животных исследовали на наличие нейтрализующих антител. Реакцию нейтрализации проводили с разными дозами вируса ВИЧ-1 (штамм ГКВ 4046). Проценты ингибирования в опыте рассчитывали по содержанию белка р24 относительно такового в контрольной мышиной сыворотке. Как видно из таблицы 2 после трехкратной иммунизации препаратами сыворотки (на 35 день после начала вакцинации) показали вируснейтрализующую активность.

Искусственные вирусоподобные частицы, полученные на основе дсРНК, декстрана (полиглюкина) и экспонирующие на своей поверхности полиэпитопный белок TBI, были названы экспериментальной вакциной против ВИЧ-1/СПИД – TBI-ВПЧ.

Таблица Нейтрализующая активность сывороток Сыворотка (разведение сывороток 1/10) % ингибирования Сыворотки мышей до иммунизации 3 - 9, Сыворотки иммунизированных мышей (группа 1) 73,1 - 79, Сыворотки иммунизированных мышей (группа 2) 79,04 - 82, Отрицательная человеческая сыворотка 3, Положительная человеческая сыворотка, содержащая анти-ВИЧ-1 50, Контроль вируса Группа 1 – иммунизация субъединичным белком TBI-gst +ПАФ, группа 2 – молекулярной конструкцией.

При создании молекулярной конструкции экспериментальной вакцины, содержащей гибридный белок gp41(607-620)- -галактозидаза, на стадии получения полисахаридной вставки в раствор с активированным полиглюкином добавляли спермидин, а вместо глутатиона аминофенилгалактопиранозид. Затем, после инкубации конъюгата с дсРНК и отделения комплекса гель-фильтрацией, к последнему добавляли раствор гибридного белка. Полученную конструкцию отделяли гель-фильтрацией от несорбировавшегося белка.

Накопление антител в сыворотке мышей, иммунизированных субъединичным белком gp41(607-620)- -галактозидаза и этим же белком в составе частиц, представлено на рис. 8. Иммунизацию проводили по той же схеме.

-lg титр 1 2 3 4 5 6 7 8 недели после начала иммунизации Рис. 8. Динамика изменения титра антител к белку gp41-16 в сыворотках животных, иммунизированных субъединичным белком gp41-16 (20 мкг на мышь) (темные столбцы) и белком gp41-16 в составе вирусоподобных частиц (20 мкг по белку) (светлые столбцы). Контрольные животные (серые столбцы). В каждом опыте использовали сыворотки от пяти животных.

Как видно на рисунке 8, вирусоподобные частицы индуцировали более высокие титры антител и пролонгировали иммунный ответ. Кроме того.

введение индуктора интерферонов – дсРНК при вакцинации наряду со стимуляцией гуморального (В-клеточного, Th2) пути должно стимулировать и Т-клеточный (Th1) иммунный ответ.

При создании конструкции вакцины, содержащей два гибридных белка, TBI-gst и gp41(607-620)- -галактозидаза, на стадии ее сборки в раствор с дсРНК вносили на девять частей конъюгата полиглюкин-спермидин-глутатион одну часть конъюгата полиглюкин-спермидин-галактопиранозид. В соответствующих отношениях затем вносили и гибридные белки. При анализе созданной конструкции вакцины электрофорезом в 10%-ном ПААГ было продемонстрировано, что она содержит оба белка, которые выявлялись при иммуноблоттинге с антителами положительной по ВИЧ-I сыворотки человека.

Следует отметить, что искусственный белок TBI не имеет в своем составе последовательности gp 41(607-620) и сочетание обоих белков в конструкции вакцины, возможно, будет способствовать увеличению ее иммуногенных свойств.

Таким образом, теоретически обоснован, рассчитан и экспериментально апробирован перспективный вариант искусственного иммуногена в виде самособирающихся вирусоподобных частиц, имеющий свойства конструктора и позволяющий составлять и экспонировать на поверхности любые белковые детерминанты, в том числе - полные наборы белков оболочек вирусов.

Создание вирусоподобных нанобиочастиц - вакцинных препаратов, содержащих белки, ковалентно связанные с матрицей. Были сконструированы и исследованы варианты частиц с полинуклеотидным комплексом внутри и антигенами на поверхности, ковалентно связанными с декстрановой оболочкой. В этих случаях синтезировали конъюгаты декстран антиген. Для придания положительного заряда молекулам конъюгатов в их состав вводили спермидин.

В связи с тем, что в отличие от молекул спермидина, глутатиона, молекулы белков могут иметь множество реакционноспособных аминогрупп, предварительно были проведены следующие эксперименты:

- по выбору соотношений количества молекул спермидина на молекулу полиглюкина (декстрана), - по исследованию продолжительности инкубации на образование конъюгатов.

На электрофореграмме (рис. 9А) видно, что комплексы из двуспиральной РНК (L и M формы), покрытой конъюгатом полиглюкин-спермидин, имеют заметно меньшую подвижность, начиная от молярных соотношений спермидин/полиглюкин в конъюгатах выше 10/1. При соотношениях 150/1 – 200/1 и выше, комплексы меняли суммарный отрицательный заряд на положительный и двигались в сторону катода (-).

На рисунке 9Б видно, что при соотношении спермидин/полиглюкин 20/ визуализируется более-менее гомогенный комплекс с кажущейся молекулярной массой 90 ± 10 кД. При более высоких соотношениях спермидин/полиглюкин (порядка 100/1) визуализируется гетерогенный комплекс конъюгатов.

При анализе реакции образовании конъюгатов с белками на электрофореграмме было видно, что в процессе получения конъюгата полиглюкина со спермидином и белком TBI-recA в молярном соотношении 1/10/1 при времени инкубации 3 ч практически весь белок TBI-recA находится в составе конъюгата и образовался достаточно гомогенный пул конъюгатов. В тех же условиях, но при соотношении 3 молекулы белка TBI-recA на одну – полиглюкина, образовался гетерогенный пул конъюгатов. На электрофореграмме было видно, что белок TBI-recA за 1 ч инкубации не полностью входил в состав конъюгата, тогда как через 3 ч мономерной формы белка в растворе не наблюдалось.

Рис. 9. А. Электрофореграмма (1%-ая агароза) препаратов молекулярных конструкций при молярных соотношениях спермидин/полиглюкин: 1 - 3/1;

2 -10/1;

3 - 50/1;

к – исходная дсРНК.

Б. Электрофореграмма (13%-ный ПААГ) препаратов конъюгатов с молярными соотношениями спермидин/полиглюкин: 1 - 20/1;

2 - 100/1;

0 – смесь полиглюкина и спермидина;

м – -галактозидаза (116000Д), БСА (66000Д) и лизоцим (14400Д).

Получение экспериментальной вакцины против туберкулеза Миковакс. При создании экспериментальной вакцины против туберкулеза белки-антигены получали из вакцинного штамма БЦЖ (Mycobacterium bovis).

Для синтеза конъюгата на 1 мг активированного полиглюкина (декстран с мол. массой 60000Д) вносили 1,6 мг суммарных очищенных белков-антигенов и 0,03 мг спермидина. В качестве центрального ядра композиции использовали дсРНК киллерного штамма Saccharomyces cerevisiae. При электронной микроскопии полученные частицы препарата имели шарообразный вид.

Одна доза препарата Миковакс содержала: дсРНК (20мкг)+белки БЦЖ (30мкг). При иммунизации экспериментальной вакциной Миковакс лабораторных животных (мыши линии ВАLB/c) (внутримышечно трехкратно с интервалом через две недели) было показано, что уровень суммарного пула антимикобактериальных антител на седьмой день после третьей иммунизации наблюдался более высоким, чем при использовании вакцинного штамма БЦЖ (30 мкг на дозу).

С целью исследования адъювантных свойств цитокинов в раствор с полученными искусственными молекулярными конструкциями вакцинного препарата Миковакс добавляли IFN- (105 МЕ на дозу) или совместно: IFN- и TNF- по 10мкг IFN- (105 МЕ) + 10мкг TNF- (105 Е) на 1 дозу. Результаты определения титров показали, что введение в состав вакцинной композиции IFN- способствовало повышению уровня антител, а добавление TNF ингибировало их синтез активность мононуклеаров иммунизированных животных изучали на 35-й день после начала иммунизации. Результаты эксперимента по влиянию на фагоцитарную активность испытанных препаратов представлены на рис. 10.

Фагоцитарный индекс 1 2 3 4 Группы животных Рис.10. Фагоцитарная активность мононуклеарных клеток на 35-е сутки после вакцинации разными образцами препаратов (р 0,05): 1- БЦЖ (30мкг), 2 – препарат частиц вакцины [дсРНК (20мкг) - белки БЦЖ (30мкг)], 3- препарат частиц + IFN 10мкг (105 МЕ), 4 - препарат частиц + IFN- 10мкг (105 МЕ) + TNF- 10мкг (105 Е), 5 физиологический раствор (контрольные животные).

Из диаграммы видно, что фагоцитарная активность мононуклеаров в группе животных, иммунизированных частицами выше, чем в группе животных, иммунизированных вакциной БЦЖ. Введение в состав вакцины препаратов IFN-, а также IFN- в сочетании с TNF- приводило к значимому повышению фагоцитарной активности.

Таким образом, экспериментальная вакцина на основе вирусоподобных частиц, состоящих из нуклеинового ядра (дсРНК), покрытого оболочкой из антигенов вакцинного штамма БЦЖ, способна индуцировать синтез антител и стимулировать фагоцитарную и пролиферативную активность. Введение IFN в состав препарата Миковакс усиливало факторы гуморального и клеточного иммунного ответа. При введении частиц со смесью IFN- и TNF- уровень образования антител снижался, но усиливался эффект клеточных факторов иммунного ответа.

Подходы к разработке вирусоподобных нанобиочастиц для доставки генов в клетки с целью создания ДНК-вакцин и терапевтических препаратов. Целью исследований было создание модели молекулярной конструкции для введения генетического материала в организм.

Молекулярная конструкция должна была защищать рекомбинантную плазмиду с встроенным геном от действия нуклеаз крови и в то же время, иметь стимулятор для проникновения ДНК в клетки.

В качестве одного из вариантов ДНК-вакцины использовали плазмиду pcDNASIL2, содержащую ген IL-2 человека под контролем CMV-промотора.

Для повышения эффективности ДНК-иммунизации были созданы препараты частиц ВПЧ-pcDNASIL2. В этих частицах ДНК плазмиды покрыта оболочкой из полианионного конъюгата полиглюкин-спермидин в соотношении: одна молекула плазмиды на 80-100 молекул конъюгата. Для сборки конструкции растворы, содержащие конъюгат и плазмидную ДНК, смешивали в соотношении 1 мг ДНК на 1,5 мг конъюгата и образовавшийся комплекс отделяли гель-фильтрацией на сефарозе CL-6B. На электрофореграмме ВПЧ-ДНК имела меньшую подвижность по сравнению с «голой» ДНК.

Оболочка должна защищать ДНК от гидролиза нуклеазами крови, обеспечивать тропизм к клеткам, имеющим отрицательный заряд на поверхности, и, являясь аналогом ДЕАЕ-декстрана, способствовать проникновению ДНК в клетки. Для проверки эффективности упаковки нуклеотидного материала в составе ВПЧ-ДНК проводили обработку препарата ВПЧ-ДНК (20 мкг) сывороткой крови (3 мкл). Эксперимент показал, что полная деградация «голой» плазмидной ДНК наблюдалась уже через мин инкубации с сывороткой, при этом в составе ВПЧ-ДНК нуклеотидный материал сохранялся интактным не менее 4 ч.

При изучении иммуногенных свойств использовали самцов мышей линии BALB/c, Каждое животное опытной группы одновременно было иммунизировано подкожно препаратом pcDNASIL2 (в дозе 50 мкг) и внутримышечно препаратом ВПЧ-pcDNASIL2 (вирусоподобные частицы, содержащие 50 мкг плазмиды pcDNASIL2). На 22 сутки иммунизация была повторена по схеме, аналогичной первой вакцинации. Контрольным группам животных вводили препарат «голой» плазмиды pcDNASIL2 (в дозе 50 мкг по выше описанной схеме) и препарат на основе векторной плазмиды, не содержащей встроенного гена IL-2.

Было установлено, что максимальный подъем концентрации IL- человека у животных опытной группы отмечался на 7 сутки после начала иммунизации. Уровень антител к IL-2 после начала иммунизации достигал пика (30±5 ТЕ/мл) на 14 сутки, второй пик регистрировался на 35 сутки (50± ТЕ/мл). В группе животных, иммунизированных «голой» плазмидой, отмечалась тенденция к статистически недостоверному (р0,05) подъему концентрации IL-2 человека.

Полученные результаты указывают на перспективность исследований препаратов ВПЧ на основе рекомбинантной плазмиды pcDNASIL2 в терапии онкологических заболеваний, а также - исследований адъювантных свойств этой конструкции при иммунизации в комплексе с различными вакцинами.

Другая, созданная аналогично конструкция, содержала ген TCI в составе ДНК-вакцины (pcDNA-TCI). При исследовании ее иммуногенных свойств мы сравнивали два способа доставки: голая плазмида pcDNA-TCI и в составе молекулярной конструкции. Было проведено тестирование гуморального и клеточного иммунного ответа у иммунизированных животных.

Гуморальный иммунный ответ оценивали по обнаружению специфических антител в сыворотке иммунизированных животных в реакции непрямого иммуноферментного анализа. При иммунизации мышей плазмидой pcDNA-TCI как в чистом виде, так и в составе вирусоподобных частиц происходила наработка специфических антител, которые связывались с белком TCI, лизатом ВИЧ-1 и с рекомбинантными белками (Env, Gag). Титры антител к белкам Env и Gag, а также лизату ВИЧ-1 оказались относительно невысокими (не выше, чем 1:80).

Клеточный цитотоксический ответ оценивали по выявлению IFN- продуцирующих лимфоцитов в реакции ELISPOT. Для рестимуляции спленоцитов in vitro использовали рекомбинантный белок TСI-gst, а также пептиды N15 (DRVIEVVQGAYRAIR- район gp 41) и N (KQIINMWQEVGKAMYA- район gp120).

Было показано, что введение полиэпитопной конструкции (как в виде голой ДНК, так и ДНК в составе вирусоподобных частиц) индуцировало появление у иммунизированных животных клонов специфических клеток, продуцирующих IFN-. Использование для рестимуляции спленоцитов in vitro как полноразмерного белка TCI, так и отдельных пептидов, входящих в его состав, указывает на то, что происходит экспрессия гена TCI, процессинг целевого белка и представление детерминант CD8+ лимфоцитам вместе с МНС I класса.

При иммунизации препаратом вирусоподобных частиц, содержащих ДНК-вакцину, клеточный ответ наблюдался более пролонгированным. Можно предположить, что пролонгированный ЦТЛ-ответ при иммунизации ВПЧ (pcDNA-TCI) по сравнению с pcDNA-TCI связан с тем, что в составе ВПЧ плазмидная ДНК защищена от действия нуклеаз и, следовательно, может циркулировать в организме более длительный период времени и трансфецировать большее количество клеток.

Конструирование искусственных иммуногенов – вирусоподобных нанобиочастиц - кандидатов в ДНК-белковые вакцины. При создании и исследовании варианта конструкции ДНК-белковой вакцины, ген TBI был клонирован под контроль эукариотического промотора (плазмида pSVK3-TBI).

В данном случае вместо рибополинуклеотидного материала (дсРНК) центрального ядра молекулярной конструкции использовался дезоксирибополинуклеотид – ДНК плазмиды pSVK3-TBI. ДНК плазмиды при вакцинации сама по себе обладает стимулирующим эффектом на иммунную систему, запуская продукцию костимулирующих цитокинов АПК. Это происходит за счет высокого содержания неметилированных динуклеотидов CpG в геномных фрагментах. Такие фрагменты взаимодействуют с рецепторами TLR9 и стимулируют активацию и созревание дендритных клеток. Эти клетки, в свою очередь, индуцируют, преимущественно, Т1 хелперную реакцию.

Разным группам животных вводили внутримышечно трехкратно с интервалом через две недели или по 12 мкг плазмиды, или по 20 мкг белка, или вирусоподобные частицы (содержащие 12 мкг плазмиды и 20 мкг белка).

Контрольной группе животных вводили по 12 мкг исходной плазмиды pSVK3.

После трехкратной иммунизации такой плазмидой (по 12 мкг на инъекцию) у мышей на пятую неделю после начала опыта титр антител к белку TBI повышался до 1:64, при этом он сохранялся на седьмую неделю и снижался на девятую до уровня контроля (рис. 11).

-lg титр Ряд Ряд Ряд Ряд 1 2 3 4 5 6 7 8 недели после начала иммунизации Рис. 11. Динамика изменения титра антител к белку TBI в сыворотках животных:

ряд 1- контрольные животные;

ряд 2- иммунизированные плазмидой pSVK3-TBI;

ряд - белками TBI-gst;

ряд 4 - конструкцией с плазмидой pSVK3-TBI в центре и с белками TBI-gst на поверхности.

Как видно на рисунке 11, при иммунизации вирусоподобными частицами, содержащими в центре плазмиду pSVK3-TBI (12 мкг), а на поверхности белок-антиген (20 мкг), титр антител к белку TBI наблюдался выше и сохранялся более длительный период времени, чем при иммунизации субъединичным белком-антигеном (20 мкг на инъекцию). Таким образом, вирусоподобные частицы вызывали пролонгацию иммунного ответа, выступая в качестве своеобразного депо антигенов инфекционного агента.

Экспериментальная вакцина против ВИЧ/СПИД – КомбиВИЧвак. В последние годы сложилось мнение, что эффективная вакцина против ВИЧ- должна индуцировать как специфический цитотоксический ответ, так и высокий уровень антител, обладающих вирус-нейтрализующей активностью.

Исходя из проведенных исследований было решено сконструировать комбинированную вакцину, объединяющую полиэпитопные В- и Т-клеточные иммуногены TBI и TCI в одной конструкции. Такая конструкция вакцины, получившая название КомбиВИЧвак, представляет собой вирусоподобную частицу (ВПЧ), в центре которой находится ДНК-вакцина pcDNA-TCI, покрытая конъюгатом спермидин-полиглюкин-TBI.

По данным атомно-силовой микроскопии, препарат вакцины КомбиВИЧвак содержит шарообразные частицы, диаметром от 40 до 100 нм и по своим размерам полученные нанобиочастицы сравнимы по величине с ВИЧ. Размеры частиц позволяют значительно повысить иммуногенность белка TBI, который представлен во множестве копий на поверхности частицы. Кроме того, оболочка из декстрана защищает ДНК-вакцину от действия нуклеаз, и способствует повышению иммуногенности ДНК-вакцины за счет повышения вероятности захвата антиген-презентирующими клетками.

Исследование иммуногенных и токсических свойств вакцины КомбиВИЧвак. Мышей линии BALB/c иммунизировали двукратно (0-й и 28-й день) вакциной КомбиВИЧвак. Опытной группе животных вводили одну дозу вакцины КомбиВИЧвак (75 мкг рекомбинантной плазмидной ДНК рсDNA TCI;

50 мкг рекомбинантного белка TBI). Контрольной группе животных вводили векторную плазмиду pcDNA 3.1, в оболочке из декстрана-полианиона (в дозе 75 мкг pcDNA 3.1 на животное), или физиологический раствор.

Спленоциты брали на 35 день (т. е. через 7 дней после второй иммунизации) для проведения реакции ELISPOT.

Результаты исследования показали, что полиэпитопные иммуногены TBI и TCI в составе вакцины КомбиВИЧвак эффективно презентировались и индуцировали вирус-специфический гуморальный и клеточный ответы.

Наибольший обратный титр антител был получен на 35-е сутки после иммунизации при использовании в качестве антигена гомологичного белка TBI (до (5±0,5)х105), но сыворотки давали хороший сигнал и при использовании в ИФА в качестве антигена лизата ВИЧ-1 (до (1,1±0,2)х103 на 35 ые сутки после иммунизации).

Вакцина КомбиВИЧвак стимулировала CTL-ответ, что было показано в 3-х различных тест-системах ELISPot (INF-gamma, IL-2 и IL-4).

Подтверждение специфичности сывороток, полученных от мышей, иммунизированных КомбиВИЧвак, было получено при использовании двух разных тест-систем в иммуноблоттинге. Антитела, индуцированные в ответ на введение вакцины, специфически распознавали белки как нативного ВИЧ-1 на стрипах из набора “New-Lav-Blot1”, так и рекомбинантные аналоги белков Env и Gag ВИЧ-1 на стрипах из набора “Блот-ВИЧ 1/2+ O” (ЗАО «Вектор Бест»).

Оценка вируснейтрализующей активности сывороток была проведена в системе in vitro на культуре клеток МТ-4 (табл. 3). На зараженной вирусом ВИЧ-1 (штамм ГКВ4046) культуре клеток сыворотки мышей, иммунизированных КомбиВИЧвак, эффективно подавляли вирусную репликацию, так же как сыворотка инфицированного человека.

Таблица Оценка вируснейтрализующей активности сывороток Сыворотка Индекс нейтрализации Разведение сыворотки 1/10 Разведение сыворотки 1/ Объединенная сыворотка 81,90% 75,60% иммунизированных КомбиВИЧвак мышей ВИЧ - инфицированного человека 99,41% 77,83% Таким образом, кандидатная вакцина КомбиВИЧвак индуцировала высокий гуморальный ответ, причем антитела высоко специфичны, они не только распознавали антигены ВИЧ-1, но и были способны нейтрализовать вирус в системе in vitro. Все эти данные свидетельствовали о том, что В клеточные эпитопы в составе частиц КомбиВИЧвак доступны для узнавания В-клетками и конформационно близки природным эпитопам ВИЧ-1 белков.

В состав TCI входят эпитопы, которые являются высоко консервативными среди 3-х основных субтипов ВИЧ-1 (А, В и С) и включают последовательности из основных вирусных белков Env, Gag, Pol и Nef. Это позволяет надеяться, что кандидатная вакцина КомбиВИЧвак будет эффективно защищать от генетически измененных вариантов ВИЧ-1 путем индукции высокого уровня CD8+ CTL, специфичных к консервативным Т-клеточным эпитопам.

Кандидатная вакцина КомбиВИЧвак обладает рядом уникальных свойств.

Она объединяет В- и Т-клеточные иммуногены в одной конструкции, один из которых является белком а другой ДНК-вакциной. Вакцина индуцировала как гуморальный, так и клеточный иммунный ответ. Она может рассматриваться как профилактическая и как терапевтическая, поскольку индуцирует ответы CTL, способные уничтожать инфицированные клетки мишени.

Создание комбинированных искусственных иммуногенов - кандидатов в вакцины. Цель данного этапа работы заключалась в разработке модели комбинированной вакцины-кандидата против ВИЧ и клещевого энцефалита на основе вирусоподобных конструкций иммуногенов с рекомбинантной плазмидной ДНК в центре и эпитопами инфекционного агента на поверхности, и исследовании интенсивности и продолжительности иммунного ответа после внутримышечного введения иммуногенов.

Для сборки молекулярных конструкций вирусоподобных частиц в качестве центрального ядра использовали ДНК плазмид pSVK3-ENS1 и pcDNA3-Es, а также, в качестве контроля, двуспиральную РНК. Получение полисахаридной оболочки – конъюгата полиглюкина с спермидином и субстратом фермента – глутатионом, и сборку вирусоподобных конструкций с белками TBI-gst на поверхности проводили смешиванием компонентов с последующим разделением продуктов гель-фильтрацией как описано ранее.

Разным группам животных (мыши линии ВАLB/c весом 18-20) вводили внутримышечно трехкратно с интервалом в две недели или по 12 мкг плазмиды, или по 20 мкг белка, или конструкции вакцин (12 мкг плазмиды, мкг белка). В качестве положительного контроля вводили конструкцию с двуспиральной РНК в центре (12 мкг РНК, 20 мкг белка), в качестве отрицательного – ДНК векторных плазмид (по 12 мкг).

При определении титров антител связавшиеся специфические антитела выявляли с помощью конъюгата антител кролика против IgG (или IgG1, или IgG2а) мыши с пероксидазой хрена («Sigma», США). Разведения используемых конъюгатов против IgG1 и IgG2a мыши предварительно нормировались так, чтобы чувствительность ИФА тестов для определения специфических IgG1, IgG2a была идентичной и, следовательно, результаты титрования IgG1, IgG2a можно сравнивать между собой.

В случае использования плазмиды pSVK3-ENS1 ген, кодирующий полноразмерные белки E и NS1 вируса клещевого энцефалита был встроен под контроль промотора SV40. В плазмиде pcDNA3-Es ген, кодирующий белок Е, укорочен с 3 -конца и встроен под контроль цитомегаловирусного промотора (CMV). Укороченный ген кодировал белок Е без его «якорной»

части и вследствие этого он способен секретироваться. В качестве поверхностного белка-иммуногена ВИЧ использовали гибридный белок TBI глутатион-s-трансфераза Динамика изменения титра антител к белку TBI в сыворотках животных после иммунизации препаратами представлена на рисунке 12.

При иммунизации животных конструкциями, содержащими в центре полинуклеотидную молекулу (ДНК или дс РНК), а на поверхности белок антиген, титры антител к белку TBI-gst наблюдались выше и сохранялись более длительный период времени, чем у животных, иммунизированных субъединичным белком (рис. 12). Присутствие в ядре конструкций плазмид генов, экспрессирующих секретируемые (Es) и внутриклеточные (ENS1) формы белков вируса клещевого энцефалита, сказывалось на уровне иммунного ответа на TBI-gst антиген.

обратный титр 1000000 антител 2нед 4нед 5нед 7нед 9нед недели после начала иммунизации Рис. 12. Динамика изменения титра антител к белку TBI в сыворотках животных:

1- животные, иммунизированные белком TBI-gst;

2- иммунизированные конструкцией с дсРНК в центре и белками TBI-gst на поверхности;

3- конструкцией с плазмидой pSVK3-ENS1 в центре и с белками TBI-gst на поверхности;

4- плазмидой pcDNA-Es в центре и с белками TBI-gst на поверхности;

5- плазмидой pcDNA-Es;

6- контрольные животные (физ. раствор). В каждом опыте анализировались сыворотки пяти животных.

Для определения преобладающего типа иммунного ответа, индуцируемого разными конструкциями плазмид с генами белков вируса КЭ и TBI-gst белком были определены изотипы антител, специфичных к антигенам Е и TBI. Экспонирование TBI-gst белка на поверхности молекулярных конструкций приводило к преобладанию Th2 типа иммунного ответа на TBI-gst антиген, причем выраженность гуморального звена иммунного ответа зависела от конструкции плазмиды, находящейся в ядре.

Для вариантов плазмиды, содержащей ген Es, Th2 тип иммунного ответа преобладал как на 7-ю, так и на 14-ю неделю после начала иммунизации. Тогда как при иммунизации конструкциями генов, экспрессирующими полноразмерные формы белков E и NS1, баланс Th2/Th1 типов иммунного ответа на поверхностный белок TBI-gst существенно зависел от сроков после иммунизации: Th2 тип значительно преобладал на 7-ю неделю и приближался по соотношению Th2/Th1 - 1/1 на 14-ю неделю после начала иммунизации.

Способность белка TBI-gst индуцировать специфический Т-хелперный ответ оценивали с помощью методики бласт-трансформации. Было установлено, что и субъединичный белок, и молекулярные конструкции с ним вызывают формирование клеток памяти, которые начиная с 3-й недели после начала иммунизации реагировали повышенной пролиферацией in vitro на антигены TBI-gst и ВИЧ.

При исследовании методом ИФА иммунного ответа на антиген вируса клещевого энцефалита было установлено, что после трехкратной иммунизации титр антител к белку Е достигал значения 1:3200 через 7 недель после начала иммунизации конструкцией, содержащей плазмиду pSVK3 ENS1, повышался на 11-ю неделю и затем снижался в течение срока наблюдения (рис. 13). Конструкции с плазмидой pcDNA3-Es индуцировали менее напряженный гуморальный иммунный ответ, который существенно снижался к 14-й неделе после начала иммунизации. При иммунизации плазмидами в составе молекулярных конструкций наблюдался более высокий титр антител к белку Е чем при иммунизации «голыми» плазмидами (рис. 13).

Вероятно, это обусловлено тем, что внешняя оболочка защищала генетический материал от нуклеаз, а положительно заряженный полиглюкин способствовал проникновению плазмидной ДНК в клетки.

обратный титр антител 7нед 11нед 14нед недели после начала иммунизации Рис. 13. Динамика изменения титра антител к белку Е в сыворотках животных:

животные, иммунизированные конструкцией с плазмидой pSVK3-ENS1 без белков оболочки;

2- иммунизированные конструкцией с плазмидой pSVK3-ENS1 в центре и белками TBI-gst на поверхности;

3-конструкцией с плазмидой pcDNA-Es в центре и с белками TBI-gst на поверхности;

4-конструкцией с исходной плазмидой pSVK3 без белков оболочки;

5- контрольные животные (физ. раствор). В каждом опыте анализировались сыворотки пяти животных.

Значительное превышение отношения титров ВКЭ-специфичных IgG1 к IgG2a свидетельствовало о преобладании Th2 типа иммунного ответа на 7-ю неделю после начала иммунизации. Данный тип иммунного ответа индуцировался обеими изученными конструкциями через 7 недель, но преобладал до 14 недели после начала иммунизации только у животных, иммунизированных конструкцией, содержащих плазмиду pcDNA3-Es с усеченным в 3’-концевой части геном белка Е, экспрессирующим в трансфицированных клетках секретируемую растворимую форму белка.

Экспрессированный полноразмерный белок Е вируса клещевого энцефалита в трансфицированной клетке, после доставки его генов в клетку плазмидой pSVK3-ENS1, презентировался на клеточной мембране в комплексе с молекулами МНС1 и, вероятно, поэтому приводил к преобладающей индукции Т-хелперов 1 типа на 14-ю неделю после начала иммунизации.

Таким образом, разработаны и апробированы перспективные варианты вирусоподобных нанобиочастиц, имеющих свойства конструктора и позволяющих создавать вакцинные препараты.

С их использованием можно повышать иммуногенность синтетических пептидов, презентируя их на поверхности наночастиц с центральным «ядром»

из полинуклеотидного комплекса (двуспиральной РНК или ДНК).

Используя частицы с центральным ядром из двуспиральной РНК (или ДНК) – экспонировать на их поверхности любые детерминанты инфекционных агентов, в том числе - полные наборы белков вирусов или бактерий.

Полианионная «оболочка» частиц способствует проникновению молекул ДНК в клетки и позволяет доставлять гены в составе плазмид в клетки мишени.

Разработанная молекулярная конструкция позволяет составлять и представлять в виде иммуногенов любые последовательности ДНК, кодирующие синтез белков-антигенов инфекционного агента и экспонировать на поверхности его (и не только его) любые белковые детерминанты.

Показано, что различные способы доставки антигена в клетки-мишени и формы презентации этих антигенов иммунокомпетентным клеткам, определяют тип иммунного ответа.

Показано, что введение IFN- в состав вакцинной композиции на основе искусственных нанобиочастиц способствует повышению уровня специфического клеточного иммунного ответа.

Созданы два варианта конструкций - кандидатов в вакцины против ВИЧ-I (TBI-ВПЧ и КомбиВИЧвак).

Для борьбы с таким социально значимым заболеванием как туберкулез, создана экспериментальная вакцина против туберкулеза (Миковакс).

Созданы искусственные иммуногены, способные вызывать индукцию специфических антител и клеточного ответа против ВИЧ-1 и вируса клещевого энцефалита.

Вакцина КомбиВИЧвак прошла предварительную регистрацию в Министерстве здравоохранения и социального развития РФ. В настоящее время получено разрешение от Комитета медицинских иммунобиологических препаратов (протокол №6 от 24 декабря 2009г.) на проведение 1 фазы клинических испытаний.

Предложена стратегия развития конструирования препаратов вирусоподобных нанобиочастиц на основе рекомбинантных молекул для терапии и профилактики вирусных и социально значимых заболеваний.

Стратегия развития конструирования препаратов вирусоподобных нанобиочастиц на основе рекомбинантных молекул для терапии и профилактики вирусных и социально значимых заболеваний.

Лекарственные Средства доставки.

средства Наночастицы (дсРНК + Лс (цитокин или др.) Генная терапия рДНК + ФАТ (факторы тропности и агдезии (Антитела, липо-, гликопротеины, агглютинины и т.д.) Вакцины Парентеральные вакцины дс РНК с конъюгатом (спермидин-декстран-субстрат) + фермент-иммуноген дс РНК с конъюгатом (спермидин-декстран- иммуноген) ДНК-вакцины рДНК в «оболочке» (спермидин-декстран) рДНК с конъюгатом (спермидин-декстран- иммуноген) Мукозальные вакцины дс РНК с конъюгатом (спермидин-декстран- иммуноген) + ФАТ (факторы тропности и агдезии (Антитела агглютинины, липо-, гликопротеины и т.д.) рДНК с конъюгатом (спермидин-декстран- иммуноген) + ФАТ (факторы тропности и агдезии (Антитела, агглютинины, липо-, гликопротеины и т.д.) ВЫВОДЫ 1. Предложена и экспериментально апробирована технология получения биомасс рекомбинантных штаммов-продуцентов цитокинов, которая включает использование отдельных, высокопродуктивных, клонов трансформированных клеток для получения посевного материала, использование в качестве посевного материала культуры клеток в первой трети логарифмической фазы роста, обработанной ампициллином в концентрациях 400-500 мкг/мл в течение 2-3 ч и сбор клеток, когда культура находится в конце логарифмической фазы роста. Ее применение позволяет повысить содержание целевых белков в биомассах (TNF- с 15 - 25% до 35 - 40%, TNF- с 2 - 4% до 12 - 16 %, G-CSF с 2,0 - 6,0 % до 10 - 12 %, GM-CSF с 2 - 5 % до 8 - 10 %).

2. Созданы экспериментальные препараты на основе интерферона- и его аналога – дельтаферона. Показано, что с помощью разработанных технологий можно получать особо чистые белки рекомбинантных интерферонов-.

Разработан метод очистки препаратов рекомбинантных белков вирусов оспы антагонистов интерферона-.

3. Получены препараты рекомбинантных белков (факторы некроза опухолей) с характеристиками, обеспечивающими их медицинское применение, и разработан метод очистки препаратов их антагонистов.

4. Разработаны технологии получения искусственных полиэпитопных белков-антигенов вируса иммунодефицита человека (TBI и TCI) для создания кандидатной вакцины против ВИЧ/СПИД.

5. Впервые предложена модель молекулярных конструкций нанобиочастиц, предназначенных для создания вакцинных композиций на основе искусственных вирусоподобных частиц с полинуклеотидным комплексом (ДНК или дсРНК) в центре и белками (или пептидами) – на поверхности.

6. Создана экспериментальная вакцина против ВИЧ-1/СПИД – TBI-ВПЧ на основе искусственных вирусоподобных частиц, содержащих в центре дсРНК а на поверхности экспонирующих антигены ВИЧ. Показано, что вакцина обеспечивает образование специфических антител.

7. Получена экспериментальная вакцина против туберкулеза (Миковакс) на основе технологии вирусоподобных частиц, экспонирующих пул суммарных белков микобактерий вакцинного штамма M.bovis. Препарат при иммунизации обеспечивал специфический клеточный ответ и образование антител против БЦЖ.

8. Продемонстрировано, что полиглюкиновая оболочка ВПЧ защищает ДНК вакцину от нуклеазной деградации и обеспечивает более эффективный иммунный ответ.

9. Впервые продемонстрирована возможность создания бивалентных вакцин на основе ВПЧ, содержащих на поверхности антигены одних возбудителей инфекции, а в составе сердцевины плазмиду с экспрессируемыми в презентирующих клетках генами антигенов другого возбудителя. С использованием предложенного подхода созданы конструкции комбинированных искусственных иммуногенов, способные вызвать индукцию специфических антител против ВИЧ-1 и вируса клещевого энцефалита.

10. На основе технологии вирусоподобных частиц создана кандидатная вакцина против ВИЧ-1/СПИД, содержащая полиэпитопный В-клеточный иммуноген TBI и плазмиду рсDNA-TCI с геном полиэпитопного Т-клеточного иммуногена TCI. Вакцина находится на 1 фазе клинических испытаний.

СПИСОК РАБОТ, ОПУБЛИКОВАННЫХ ПО ТЕМЕ ДИССЕРТАЦИИ Статьи в ведущих научных журналах, рекомендованных ВАК Минобразования и науки РФ для публикации основных результатов диссертации 1. Volosnikova E.A., Akulova N.I., Gogina Ya.S., Levagina G.M., Mikhailova Y.K., Lebedev L.R., Podgornyi V.F., Telegina Yu.V.. Development of technology for purification of plasmid DNAs for pharmaceutical purposes // Applied Biochemistry and Microbiology. – 2010. - №9. – Р. 59 – 64.

2. Волосникова Е.А., Лебедев Л.Р., Акулова Н.И. Очистка рекомбинантного белка TBI – антигена ВИЧ // Биотехнология. - 2010. - №4. - С. 65-68.

3. Непомнящих Т.С,, Антонец Д.В., Лебедев Л.Р., Гилева И.П., Щелкунов С.Н.

Моделирование пространственных структур комплексов TNF-связывающих белков CrmВ вируса натуральной оспы и вируса оспы коров с TNF мыши и человека // Молекулярная биология – 2010. - Т.44 - № 6. - С.1054-1063.

4. Волосникова Е.А., Лебедев Л.Р., Каплина О.Н., Карпенко Л.И., Акулова Н.И., Рослякова Е.Ю. Иммунологическая характеристика вакцины КомбиВИЧвак против ВИЧ/СПИД. Совершенствование способов получения // Вест. Урал. мед. академ. науки. - 2010. - №2/1 (29). - С. 245. – (Тематич. вып.

по аллергологии и иммунологии).

5. Гамалей С.Г., Батенева А.В., Сысоева Г.М., Даниленко Е.Д., Лебедев Л.Р., Масычева В.И. Фармакокинетика и противоопухолевые свойства препарата, содержащего ФНО- в составе наночастицы // Бюл. эксперим. биол. и мед. 2010. - Т. 149. - № 3. - С. 296-299.

6. Гамалей С.Г., Сысоева Г.М., Фадина В.А., Даниленко Е.Д., Лебедев Л.Р., Масычева В.И. Сравнительное изучение провоспалительных свойств мутантных аналогов ФНО-альфа // Вест. Урал. мед. академ. науки. - 2009. №2/1 (24).- С.24-25 - (Тематич. вып. по аллергологии и иммунологии).

7. Bazhan S.I., Karpenko L.I., Lebedev L.R., Uzhachenko R.V., Belavin P.A., Eroshkin A.M., Ilyichev A.A. A synergistic effect of a combined bivalent DNA– protein anti-HIV-1 vaccine containing multiple T- and B-cell epitopes of HIV- proteins // Molecular Immunology. - 2008. – V.45. - Р. 661–669.

8. Лебедев Л.Р., Карпенко Л.И., Даниленко Е.Д., Рыжиков А.Б., Бажан С.И., Масычева В.И.,Ильичев А.А. Молекулярные конструкции нанобиочастиц для вакцинологии // Российский иммунологический журнал.- 2008. - Т.2 (11). - № 2-3. - С.337-338.

9. Бабкин И.В., Рязанкин И.А., Лебедев Л.Р., Булычев Л.Е., Нестеров А.Е.

Носарева О.В., Бабкина И.Н. Иммуногенные свойства рекомбинантного вируса осповакцины, содержащего ген IL-2 человека // Вопр. вирусол.-2008. - №1. С.27-31.

10. Аликин Ю.С., Масычева В.И., Подгорный В.Ф., Лебедев Л.Р., Даниленко Е.Д., Клименко В.П. Перспективы разработки противоинфекционных средств на основе РНК // Вест. Рос. Военно-мед. Акад. - 2008. - №2 (22).- приложение (ч.1). - С. 146-147.

11. Леванов Л.Н., Матвеев Л.Э., Юн Т.Э., Лебедев Л.Р., Швалов А.Н., Байков И.К., Матвеева В.А., Рихтер В.А., Тикунова Н.В. Одноцепочечное антитело против гликопротеина Е вируса клещевого энцефалита // Сибирский медицинский журнал. - 2008. – № 7. – С.38-43.

12. Даниленко Е.Д., Лебедев Л.Р., Сысоева Г.М., Гамалей С.Г., Батенева А.В., Устименко С.Ю., Масычева В.И. Поиск способов улучшения терапевтических свойств фактора некроза опухолей альфа как средства лечения онкопатологии // Российский иммунологический журнал. - 2008. -Т.2 (11).- № 2-3. - С. 306.

13. Лебедев Л.Р., Карпенко Л.И., Даниленко Е.Д., Рыжиков А.Б., Бажан С.И., Масычева В.И., Ильичев А.А. Молекулярные конструкции нанобиочастиц для вакцинологии // Российский иммунологический журнал.-2008. - Т.2 (11). - № 2-3. - С. 337.

14. Karpenko L.I., Ilyichev A.A. Eroshikin A.M., Lebedev L.R., Uzachenko R.V., Nekrasova N.A., Plyasynova O.A., Belavin P.A., Seregin S.V., Danilyuk N.K., Zaitsev B.N., Danilenko E.D., Masycheva V.I., Bazhan S.I. Combined virus-like particle-based polyepitope DNA/protein HIV-1 vaccine design, immunogenicity and toxicity studies // Vaccine. - 2007. - Vol. 25 – N 21. - P. 4312-4323.

15. Лебедев Л.Р., Булычев Л.Е., Бабкин И.В., Нестеров А.Е., Носарева О.В., Бабкина И.Н. Изучение цитокинового профиля при иммунизации геном интерлейкина-2 человека в составе рекомбинантной плазмиды // Иммунология. - 2007. - № 3. - С. 143-147.

16. Karpenko L.I.,Bazhan S.I., Eroshikin A.M., Lebedev L.R., Uzachenko R.V., Nekrasova N.A., Plyasynova O.A., Belavin P.A., Seregin S.V., Danilyuk N.K., Danilenko E.D., Zaitsev B.N., Masicheva V.I., Ilyichev A.A., Sandakhchiev L.S.

«CombiHIVvac – Vaccine which contains polyepitohe B- and T-cell Immunogens of HIV-1 // Doklady biochemistry and biophysics. - 2007. - V. 413. -P. 65-67.

17. Азаев М.Ш., Лебедев Л.Р., Кузьмичева Г.А., Туманов Ю.В., Донченко Н.А., Татьков С.И., Носарева О.В., Ильичев А.А. Исследование роли искусственных микробактериальных частиц в реализации иммунологических процессов при экспериментальном туберкулезе животных // Проблемы туберкулеза и болезней легких. - 2007. - № 2. - С. 38-42.

18. Веремейко Т.А., Лебедев Л.Р., Чикаев Н.А., Ильичев А.А., Карпенко Л.И.

Гуморальный иммунный ответ мышей линии BALB/c, иммунизированных химерными белками HbcAg, несущими эпитопы поверхностного белка вируса гепатита B // Вопр. вирусол. - 2007. - Т.52.- № 1. - С. 40-45.

19. Татьков С.И., Носарева О.В., Болдырев А.Н., Смирнова О.Ю., Туманов Ю.В., Лебедев Л.Р., Порываева В.А., Ивлев-Дунтау А.П., Аутеншлюс А.И., Ткаченко С.Б., Стрелис А.К., Новицкий В.В., Уразова О.И., Воронкова О.В.

Применение рекомбинантных видоспецифических белков M. tuberculosis для серологической диагностики туберкулеза // Клиническая лабораторная диагностика.- 2006. - № 12. - С. 23-34.

20. Гилева И. П., Малкова Е.М., Непомнящих Т. С, Виноградов И.В., Лебедев Л. Р., Кочнева Г.В., Гражданцева А.А. Рябчикова Е.И., Щелкунов С.Н. Изучение действия TNF-связывающего белка вируса натуральной оспы на развитие ЛПС-индуцированного эндотоксического шока // Цитокины и воспаление. 2006. – Т.5. - №1. - С. 44-48.

21. Татьков С.А., Туманов Ю.В., Носарева О.В., Болдырев А.Н., Смирнова О.Ю., Лебедев Л.Р., Порываева В.А., Ивлев-Дунтау А.П., Ткаченко С.Б., Стрелис А.К., Новицкий В.В., Уразова О.И., Воронкова О.В. Применение рекомбинантных видоспецифических белков микобактерий туберкулеза для серологической диагностики инфекции // Эпидемиология и Вакцинопрофилактика. - 2006. - 4(29) - С. 42-47.

22. Gileva I.P., Nepomnyashchikh T.S., Antonets D.V., Lebedev L.R., Kochneva G.V., Grazhdantseva A.V., Shchelkunov S.N. Properties of the recombinant TNF binding proteins from variola, monkeypox, and cowpox viruses are different // Biochim Biophys Acta. - 2006. - Vol.1764. - N11. - P. 1710-1718.

23. Мирошников П.Н., Лебедев Л.Р. Разработка лекарственного препарата Дельтаферон на основе аналога рекомбинантного гамма-интерферона человека // Вест. Биотехнологии и физ.-хим. биологии им. Ю.А.

Овчинникова.- 2006. - Т. 2. - № 2. - С. 5-10.

24. Непомнящих Т.С., Лебедев Л.Р., Рязанкин И.А., Поздняков С.Г., Гилева И.П., Щелкунов С.Н. Сравнение рекомбинантных интерферон--связывающих белков вирусов натуральной оспы и оспы обезьян // Молекулярная биология.

- 2005. - Т.39. - № 6. - С. 1055-1062.

25. Nepomnyashchih T.S., Lebedev L.R., Kochneva G.V., Grajdantceva A.A., Ryazankin I.A., Shchelkunov S.N., Gileva I.P. Orthopoxvirus tumor necrosis factor binding proteins and gamma-interferon binding proteins: expression, purification and some characteristics // FEBS Journal – 2005. - 272 (s1, L1-031P).

26. Гилева И.П., Рязанкин И.А., Непомнящих Т.С., Тотменин А.В., Максютов З.А., Лебедев Л.Р., Афиногенова Г.А., Пустошилова Н.М., Щелкунов С.Н. Экспрессия генов TNF-связывающих белков ортопоксвирусов в клетках насекомых и изучение свойств рекомбинантных белков // Молекулярная биология. - 2005. - Т.39. - № 2. - С. 245-254.

27. Ильичев А. А., Карпенко Л. И., Некрасова Н. А., Лебедев Л. Р., Игнатьев Г. М., Агафонов А. П., Белавин П. А., Серегин С. С., Данилюк Н. К., Бажан С. И.

Использование различных систем доставки ВИЧ-1 ДНК-вакцины, кодирующей поли-ЦТЛ-эпитопный иммуноген // Вестник Российской академии медицинских наук. - 2005. - №1. - С. 41-43.

28. Мирошников П.Н., Лебедев Л.Р., Терещенко Т.А. Получение интерферона-гамма и его аналога дельтаферона // Биотехнология. - 2005. - № 1. - С. 11-18.

29. Азаев М.Ш., Лебедев Л.Р., Туманов Ю.В., Смирнова О.Ю., Кузьмичва Г.А., Боднев С.А., Донченко Н.А., Татьков С.И. Получение искусственных миккобактериальных частиц и исследование их иммуногенных свойств // Биотехнология. - 2004. - №4. - С. 34-40.

30. Кашперова Т.А., Ромашова Н.Г.. Нестеров А.В., Лебедев Л.Р., Белявская В.А. Конструирование лечебно-профилактических препаратов на основе живых генетически модифицированных микроорганизмов. 1.

Конструирование генетически модифицированных микроорганизмов для разработки нового поколения иммунобиологических и вакцинных препаратов // Биотехнология. - 2004. - № 5. - С. 39-49.

31. Karpenko L.I., Nekrasova N.A., Ilyichev A.A., Lebedev L.R., Ignatyev G.M., Agafonov A.P., Zaitsev B.N., Belavin P.A., Seregin S.V., Danilyuk N.K., Babkina I.N., Bazhan S.I. Comparative analysis using a mouse model of the immunogenicity of artificial VLP and attenuated Salmonella strain carrying a DNA-vaccine encoding HIV-1 polyepitope CTL-immunogen // Vaccine. – 2004. -Apr 16;

22(13-14). – Р. 1692 1699.

32. Bazhan S.I., Belavin P.A., Seregin S.V., Danilyuk N.K., Babkina I.N., Karpenko L.I., Nekrasova N.A., Lebedev L.R., Ignatyev G.M., Agafonov A.P., Poryvaeva V.A., Aborneva I.V., Ilyichev A.A. Designing and engineering of DNA vaccine construction encoding multiple CTL-epitopes of major HIV-1 antigens // Vaccine. - 2004. - Apr 16;

22(13-14). - Р. 1672-1682.

33. Bazhan S.I., Belavin P.A., Seregin S.V., Danilyuk N.K., Babkina I.N., Karpenko L.I., Nekrasova N.A., Lebedev L.R., Agafonov A.P., Ignat'ev G.M., Il'ichev A.A., Sandakhchiev L.S. Construction of an artificial immunogen, a candidate DNA vaccine encoding multiple CTL epitopes of HIV-1 // Dokl Biochem Biophys. - 2004.

– 395. - Р.108-110.

34. Karpenko L.I., Lebedev L.R., Ignatyev G.M., Agafonov A.P., Poryvaeva V.A., Pronyaeva T.R., Ryabchikova E.I., Pokrovsky A.G., Ilyichev A.A. Construction of artificial virus-like particles exposing HIV epitopes, and the study of their immunogenic properties // Vaccine. - 2003. - V.21. – N 5-6. - P. 386-392.

35. Лебедев Л.Р., Белявская В.А. Получение высокополимерных антигенных структур с повышенными иммуногенными свойствами // Журнал микробиологии, эпидемиологии и иммунологии. - 2003. - № 6. - С. 41 45.

36. Gileva I.P., Ryazankin I.A., Maksyutov Z.A., Totmenin A.V., Lebedev L.R., Nesterov A.E., Ageenko V.A., Shchelkunov S.N., Sandakhchiev L.S. Comparative assessment of the properties of orthopoxviral soluble receptors for tumor necrosis factor // Dokl Biochem Biophys. - 2003. – 390. - Р. 160-164.

37. Lebedev L.R., Goncharova E.P., Sizov A.A., Bulychev L.E., Odegov A.M., Ryzhikov A.B. Experimental molecular design of recombinant vaccines // Mol. Biol.

(Mosk). - 2003. - 37(3). - Р. 544-549.

38. Одегов А.М., Сизов А.А, Лебедев Л.Р., Кашперова Т.А., Максимова В.О., Пустошилова Н.М. Масычева В.И. Создание экспериментального набора реагентов для количественного определения фактора некроза опухолей-альфа в биологических жидкостях методом иммуноферментного анализа // Биотехнология.- 2003. - 2. - С. 76 -80.

39. Ильичев А.А., Карпенко Л.И., Бажан С.И., Бабкина И.Н., Белавин П.А., Серегин С.В., Данилюк Н.К., Игнатьев Г.М., Агафонов А.П., Нестеров А.Е., Рязанкин И.А., Поздняков С.Г., Щелкунов С.Н., Масычева В.И., Сизов А.А., Пустошилова Н.М., Левагина Г.М., Даниленко Е.Д., Лебедев Л.Р., Кашперова Т.А., Терещенко Т.А., Одегов А.М., Литовченко Л.Л., Федосова Л.К., Афиногенова Г..Н., Михайлова В.И., Меламед Н.В., Веремейко Т.А., Хомякова С.Н., Некрасова Н.А., Савкин И..В., Воробьева М.С., Жучков А.В., Шекшеев Э.М., Сандахчиев Л.С. Разработка генно-инженерных вакцин против ВИЧ/СПИД на основе векторных систем, включающих искусственные гены, кодирующие актуальные антигенные детерминанты ВИЧ // Аллергология, астма и клиническая иммунология. – 2003. –Т.7. - № 9. – С.121 - 125.

40. Карпенко Л.И., Бажан С.И., Игнатьев Г.М., Лебедев Л.Р., Ильичев А.А., Сандахчиев Л.С. Искусственные анти-ВИЧ-иммуногены и способы их доставки // Вест. РАМН. - 2003. – N 1. - С. 24-30.

41. Lebedev L.R., Azaev M.Sh., Tumanov Y.V., Sizov A.A., Il'ychev A.A., Tat'kov S.I. Artificial mycobacterial particles for immunization against tuberculosis // Dokl.

Biol. Sci. - 2002. - 387. - Р. 488-490.

42. Lebedev L.R., Goncharova E.P., Sizov A.A., Bulychev L.E., Odegov A.M., Ignat'ev G.M., Ryzhikov A.B. A model of molecular constructions of a combined bivaccine // Dokl Biochem Biophys. - 2002. - 384. -Р. 140-142.

43. Goncharova E.P., Ryzhikov A.B., Bulychev L.E., Sizov A.A., Lebedev L.R., Poryvaev V.D., Karpenko L.I., Il'ichev A.A. A study of systems for delivering antigens and plasmid DNA for intranasal immunization against tick-borne encephalitis virus // Wien Klin Wochenschr. – 2002. - 114(13-14). - Р. 630-635.

44. Карпенко Л.И., Игнатьев Г.М., Агафонов А.П., Порываева В.А., Лебедев Л.Р., Веремейко Т.А., Некрасова Н.А., Климов Н.А., Козлов А.П., Ильичев А.А.

Конструирование и исследование антигенных свойств рекомбинантного штамма сальмонеллы, продуцирующей белок ТВI // Вопр. вирусол. - 2002. – N 2. - С. 25-28.

45. Сизов А.А., Лебедев Л.Р., Кашперова Т.А., Одегов А.М., Афиногенова Г.Н., Даниленко Е.Д., Сысоева Г.М., Масычева В.И. Изучение возможности создания экспериментальной вакцины против гепатита С на основе вирус подобной конструкции для интраназального введения // Биотехнология. 2002. – N 1. - С.11-14.

46. Lebedev L.R., Sizov A.A., Karpenko L.I., Poryvaeva V.A., Odegov A.M.

Molecular construction of experimental combined vaccines // Mol. Gen. Mikrobiol.

Virusol. - 2002. - 1. -Р. 17-21.

47. Лебедев Л.Р., Рязанкин И.А., Сизов А.А., Агеенко В.А., Одегов А.М., Афиногенова Г.Н., Щелкунов С.Н. Способ очистки антагонистов фактора некроза опухолей и исследование их некоторых свойств.// Биотехнология. 2001. - № 6. - С.14-18.

48. Белявская В.А., Лебедев Л.Р., Бондаренко В.М. Иммноген ВИЧ gp 41-16 в составе гибридного белка и способы его предъявления иммунной системе // Биотехнология. - 2001. – N 5. - С.25-31.

49. Сизов А.А., Лебедев Л.Р., Кашперова Т.А., Одегов А.М., Алексенцев В.А., Масычева В.И. Исследование динамики синтеза специфических IgG после ДНК-иммунизации кролика вирусподобной конструкцией, содержащей ген чГ-КСФ // Биотехнология. - 2001. – N 5. - C. 21-24.

50. Литовченко Л.Л., Кривопалова Г.Н., Каньшина А.В., Лебедев Л.Р., Пустошилова Н.М. Исследование популяций рекомбинантных штаммов E.

Coli, синтезирующих ФНО-альфа и Г-КСФ, в процессе получения биомассы // Биотехнология. - 2001. - № 3. - С. 11-17.

51. Sizov A.A., Lebedev L.R., Kashperova T.A., Odegov A.I., Masycheva V.I.

Development of virus - like construction for receptor-dependent transport of the recombinant hG-CSF gene in vivo // Russian J. Biotech. - 2001. - V.1 - P. 8-11.

52. Lebedev L.R., Sizov A.A, Masycheva V.I., Karpenko L.I., Ryazankin I.A. A Molecular Vector for the Gene Delivery to the Target Cells // Russian J. Biotech. 2001. - V.1.- P. 1-7.

53. Lebedev L.R., Karpenko L.I., Poryvaeva V.A., Azaev M.S., Ryabchikova E.I., Gileva I.P., Ilychev A.A. Construction of virus-like particles exposing HIV-I epitops // Mol. Biol. – 2000. - V.34. - № 3 - Р. 413-417.

54. Татьков С.И., Смирнова О.Ю., Цивковский Р.Ю., Кочнева Г.В., Кузьмичева Г.А., Христофоров В.С., Косарев И.С., Черных Е.Р., Хонина Н.А., Лебедев Л.Р., Даниленко Е.Д., Фадина В.К., Пустошилова Н.М., Масычева В.И., Сандахчиев Л.С. Мутантный -интерферон человека с укороченным С-концом и его свойства // Доклады академии наук. - 2000. –Т. 372. - № 6. - С. 833-835.

55. Лебедев Л.Р., Гилева И.П., Карпенко Л.И., Ерошкин А.М.

Конструирование оригинальных искусственных иммуногенов – кандидатов в вакцины против HIV-I // Молекулярная генетика, микробиология и вирусология. - 2000. - № 3. - С. 36-40.

56. Гамалей С.Г., Даниленко Е.Д., Емельянова А.В., Лебедев Л.Р., Пустошилова Н.М., Масычева В.И. Особенности фармакокинетики нового структурного аналога фактора некроза опухолей альфа // Химико фармацевтический журнал. - 1999. -№ 11. - С. 3-5.

57. Михайлов А.М., Локтев В.Б., Лебедев Л.Р., Ерошкин А.М., Корнев А.Н., Корнилов В.В., Вайнштейн Б.К. Кристаллизация и рентгенодифрационное исследование строения искусственного белка TBI, экспериментальной многоэпитопной вакцины против ВИЧ-1 // Кристаллография. - 1999. - Т.44. – N 5. - С. 930-932.

58. Лебедев Л.Р., Зернов Ю.П., Каньшина А.В., Кривопалова Г.Н., Литовченко Л.Л., Пустошилова Н.М. Оптимизация процесса биосинтеза гранулоцитарного колониестимулирующего фактора при культивировании рекомбинантного штамма E.coli SG 200-50/pGGF // Биотехнология. - 1998. – N 2. - С. 44-51.

59. Лебедев Л.Р., Пустошилова Н.М., Андреева И.С., Синичкина С.А.

Получение лимфотоксина и изучение его свойств // Прикладная биохимия и микробиология. - 1998. - Т.34. – N 1. - С. 120-126.

60. Сандахчиев Л.С., Мерзликин Н.В., Пустошилова Н.М., Истомина Н.Н., Лебедев Л.Р., Святченко М.И., Даниленко Е.Д., Масычева В.И., Усова С.В.

Некоторые биологические свойства мутантного фактора некроза опухолей альфа человека // Бюл. эксперим. биол. и мед.-1998. - Т.125. – N 1. - С.89-92.

61. Лебедев Л.Р., Ерошкин А.М., Гилева И.П. Способ получения синтетического белка – кандидата в вакцины против HIV-I // Биотехнология. 1997. - № 7-8. - С. 38-42.

62. Масычева В.И., Даниленко Е.Д., Морозова Е.Н., Федосова Л.К., Сизова Л.Ю., Гамалей С.Г., Лебедев Л.Р., Пустошилова Н.М. Изучение токсических свойств рекомбинантного фактора некроза опухолей-бета человека // Антибиотики и химиотерапия. - 1996. – N 4. - С. 24-27.

63. Андреева И.С., Лебедев Л.Р., Синичкина С.А., Пучкова Л.И., Пустошилова Н.М. Исследование биосинтеза интерферона альфа-2 и факторов некроза опухолей на стадиях культивирования // Мол. генетика, микробиол. и вирусол. - 1996 – N 3. - С. 23-26.

64. Лебедев Л.Р., Андреева И.С., Пустошилова Н.М. Исследование биосинтеза рекомбинантного лимфотоксина человека в клетках E.coli // Биотехнология. - 1996. – N 1. - С. 9-12.

65. Лебедев Л.Р., Зернов Ю.П., Андреева И.С., Пустошилова Н.М.

Разработка технологии получения фактора некроза опухолей и его исследования // Биотехнология. - 1995 – N 12. - С. 19-24.

66. Eroshkin A.M., Karginova E.A., Gileva I.P., Lomakin A.S., Lebedev L.R., Kamynina T.P., Pereboev A.V., Ignatiev G.M. Desing of four-helix-bundle protein as a candidate HIV vaccine // Protein Engeneering.- 1995. - V.8. -N.2. - Р. 167-173.

67. Razvorotnev V.A., Masycheva V.I., Pustoshilova N.M., Lebedev L.R. The influence of recombinant TNF-beta on the development of the cell-mediated and humoral immune response // International J. of Immunorehabilitation. - 1994. –N 1.

- Р. 290.

68. Корепанова А.В., Ерошкин А.М., Иванисенко М.А., Микрюков Н.Н., Лебедев Л.Р., Пустошилова Н.М., Петренко В.А., Ильичев А.А. Получение мутантного фактора некроза опухолей человека с повышенной устойчивостью к протеазам // Мол. биология. - 1994. - Т.28. - Вып.1. - С. 143-149.

69. Коробко В.Г., Добрынин В.Н., Давыдов И.В., Лебедев Л.Р., Гилева И.П., Пустошилова Н.М., Петренко В.А. Получение и бактериальная экспрессия мутантного гена лимфотоксина человека // Биоорган. химия.-1993. - Т.19. – N 4. - С. 414-419.

Работы, опубликованные в сборниках научных трудов, монографии 70. Акулова Н.И., Блинова Л.И., Гогина Я.С., Лебедев Л.Р. Изучение мутагенного действия нанобиочастиц методом Эймса // Достижения современной биотехнологии: Сб. науч. тр./ Под ред. проф. И. Г. Дроздова. Новосибирск. - 2008. - С. 233-240.

71. Аликин Ю.С., Лебедев Л.Р., Подгорный В.Ф., Рослякова Е.Ю., Сысоева Г.М., Фадина В.А., Белкина А.О. Влияние разных форм природных РНК на иммунный ответ // Достижения современной биотехнологии: Сб. науч. тр./ Под ред. проф. И. Г. Дроздова.- Новосибирск.- 2008. - С. 92-103.

72. Гамалей С.Г., Сысоева.Г.М., Батенева А.В., Даниленко Е.Д., Лебедев Л.Р., Масычева В.И. Исследование противоопухолевых свойств наноконструкций, несущих фактор некроза опухолей альфа // Достижения современной биотехнологии: Сб. науч. тр./ Под ред. проф. И. Г. Дроздова.- Новосибирск. 2008. - С. 185-193.

73. Даниленко Е.Д., Гамалей С.Г., Сысоева Г.М., Батенева А.В., Устименко С.Ю., Бабенко О.А., Шимина Г.Г., Лебедев Л.Р., Акулова Н.И., Масычева В.И.

Изучение токсичности нанобиочастицы для адресной доставки терапевтических средств к клеткам-мишеням // Достижения современной биотехнологии: Сб. науч. тр./ Под ред. проф. И. Г. Дроздова.- Новосибирск. 2008. - С. 194-204.

74. Подгорный В.Ф., Лебедев Л.Р., Аликин Ю.С. Методические аспекты получения композиционных препаратов на основе рибонуклеиновых кислот// Достижения современной биотехнологии: Сб. науч. тр./ Под ред.

д.м.н., проф. И.Г. Дроздова.- Новосибирск.- 2008. – С. 59-68.

75. Карпенко Л.И., Бажан С.И., Ужаченко Р.В., Некрасова Н.А., Лебедев Л.Р., Агафонов А.П., Веремейко Т.А., Левагина Г.М., Даниленко Е.Д., Масычева В.И., Богрянцева М.П., Плясунова О.А., Ильичев А.А. Различные формы кандидатных вакцин против ВИЧ-1, несущих полиэпитопные иммуногены // Биопрепараты. - 2006. - N4. - С. 8-11.

76. Лебедев Л.Р., Федосов С.А. Повышение иммуногенности коротких пептидов с помощью полианионов // Сборник научных трудов сотрудников Института медицинской биотехнологии ФГУН ГНЦ ВБ «Вектор». Бердск. 2006.- С. 308-315.

77. Гамалей С.Г., Сысоева Г.М., Даниленко Е.Д., Лебедев Л.Р., Масычева В.И.

Противоопухолевые свойства мутантного аналога фактора некроза опухоли альфа // Сборник научных трудов сотрудников Института медицинской биотехнологии ФГУН ГНЦ ВБ «Вектор». Бердск.- 2006.- С. 80-88.

78. Мирошников П.Н., Аликин Ю.С., Подгорный В.Ф., Лебедев Л.Р.

Методы оценки и стандартизации образцов двуцепочечных РНК // Сборник научных трудов сотрудников Института медицинской биотехнологии ФГУН ГНЦ ВБ «Вектор». Бердск.- 2006.- С. 139-147.

79. Карпенко Л.И., Бажан С.И., Некрасова Н.А., Юдина О.С., Ключ Б.П., Веремейко Т.А., Белавин П.А., Серегин С.В., Данилюк Н.К., Лебедев Л.Р., Терещенко Т.А., Левагина Г.М., Масычева В.И., Чеканова Т.А., Расщепкина М.Н., Воробьева М.С., Ильичев А.А. Инъекционная и суппозиторная формы кандидатных вакцин против ВИЧ/СПИД на основе полиэпитопных иммуногенов // Физиология и патология иммунной системы. - 2005. - Т.9. - № 7. - С. 90-95.

80. Belyavskaya V.A., Kashperova T.A., Lebedev L.R., Masycheva V.I.

Biotechnological aspects of designing genetically modified microorganisms // Biotechnology and Medicine. Editor G.E.Zaikov et. al. Nova Science Publishers, Inc.,New York. - 2004. - Р. 107-119.

81. Лебедев Л.Р., Путинцева Н.И. "Рекомбинантные гибридные белки:

современное состояние и области использования". ГНИИЭМП. Мин.

экономики РФ. Химико-фармацевтическое производство. Обзорная информация. - М. - 1997. - Вып.4. - 11с.

82. Пустошилова Н.М., Путинцева Н.И., Лебедев Л.Р. "Фактор некроза опухолей-бета (лимфотоксин): современное состояние и перспективы использования". ГНИИЭМП. Мин.экономики РФ. Химико-фармацевтическое производство. Обзорная информация. - М. - 1997. - Вып.1. - 26с.

83. Zakabunin A.I., Baranovskaya G.A., Lebedev L.R., Pustoshilova N.M. "The development of the method of purification of the immune interferon analog".//Russian Journal of HIV/AIDS and Related Problems. - 1997. - T.1. - N.1. Р. 270.

Патенты на изобретения 1. Масычева В.И., Лебедев Л.Р., Даниленко Е.Д., Сысоева Г.М., Гамалей С.Г.

Противоопухолевое средство на основе наночастиц, несущих рекомбинантный фактор некроза опухолей альфа. Патент РФ № 2386447 от 13.10.08, опубл.

20.04.2010, Бюл. № 11.

2. Непомнящих Т.С., Гилева И.П., Лебедев Л.Р., Щелкунов С.Н.

Рекомбинантная плазмидная ДНК pFasfflac-G2E4gG, содержащая фрагмент генома вируса натуральной оспы, кодирующий фактор некроза опухолей связывающий белок, и фрагмент генома человека, кодирующий участок тяжелой цепи иммуноглобулина G, и штамм бакуловируса BvG2RIgG, продуцирующий растворимый химерный белок, состоящий из белка вируса натуральной оспы, связывающего фактор некроза опухолей, и фрагмента тяжелой цепи иммуноглобулина G человека. Патент РФ № 2376375 от.

18.02.2008, опубл. 20.12.2009, Бюл. № 35.

3. Мирошников П.Н., Лебедев Л.Р., Масычева В.И. Препарат аналога рекомбинантного интерферона гамма человека и способ его получения.

Патент РФ № 2326944 от 14.08.2006, опубл. 20.06.2008, Бюл. № 17.

4. Карпенко Л.И., Лебедев Л.Р., Бажан С.И., Некрасова Н.А., Белавин П.А., Серегин С.В., Данилюк Н.К., Ерошкин А.М., Ильичев А.А. Рекомбинантная вакцина против вируса иммунодифицита человека 1 типа. Патент РФ № 2317107 от 10.01.2006, опубл. 20.02.2008, Бюл. № 5.

5. Азаев М.Ш., Лебедев Л.Р., Кузьмичва Г.А., Татьков С.И. Искусственные микобактериальные частицы и вакцинная противотуберкулзная композиция на их основе. Патент РФ № 2242245 от 10.01.2003, опубл. 20.12.2004, Бюл. № 19.

6. Сизов А.А., Лебедев Л.Р., Масычева В.И., Даниленко Е.Д. Молекулярный вектор для доставки генов в клетки-мишени. Патент РФ № 2190018 от 14.08.2000, опубл. 27.09.2002, Бюл. № 27.

7. Лебедев Л.Р., Карпенко Л.И., Ильичев А.А. Вакцина против вирусных инфекций.. Патент РФ №2217162 от 10.04.2000, опубл. 27.11.2003, Бюл. № 33.

8. Лебедев Л.Р., Каньшина А.В., Литовченко Л.Л.. Кривопалова Г.Н., Масычева В.И., Пустошилова Н.М. Способ получения биомасс рекомбинантных штаммов E.coli, обогащенных полипептидами со свойствами цитокинов человека. Патент РФ № 2158303 от 19.10.1998, опубл. 27.10.2000, Бюл.

№ 30.

9. Синичкина С.А. Пустошилова Н.М., Масычева В.И., Лебедев Л.Р., Коробко В.Г. Способ получения рекомбинантного ФНО-бета человека. Патент РФ №2132385 от 10.04.1997, опубл. 27.06.1999, Бюл. № 18.

10. Лебедев Л.Р., Андреева И.С., Пустошилова Н.М. Способ получения биомассы E.coli, обогащенной полипептидом со свойствами лимфотоксина человека. Патент РФ № 2122580 от 12.03.1997, опубл. 27.11.1998, Бюл. № 33.

11. Пустошилова Н.М., Лебедев Л.Р., Гилева И.П., Коробко В.Г., Давыдов И.В., Петренко В.А. Способ получения полипептида со свойствами лимфотоксина человека. Патент РФ № 2048521 от 25.05.1992, опубл. 20.11.1995, Бюл. № 32.

Научно-техническая документация 1. Инструкция по изготовлению и контролю "Фактор некроза опухолей рекомбинантный человеческий бета (субстанция)", ИК 103.1591.30-92.

2. Инструкция по изготовлению и контролю «Фактор некроза опухолей рекомбинантный человеческий бета (бефнорин лекарственная форма)», ИК 103.1591.39-97.

3. Инструкция по изготовлению и контролю «Аналог фактора некроза опухолей альфа человеческий рекомбинантный (субстанция)», (проект).

4. Инструкция по изготовлению и контролю «Рекомбинантный аналог человеческого интерферона-гамма, дельтаферон (субстанция)», ИК 00479979 45-04.

5. Инструкция по изготовлению и контролю. «Рекомбинантный аналог человеческого интерферона-гамма, дельтаферон (Дельтаферон, лекарственная форма)» ИК 00479979-45-04.

6. Производственный регламент «Т- и В-клеточный иммуноген вируса ВИЧ-1 (субстанция)», 1291-эпр.

7. Инструкция по изготовлению и контролю «Вакцина против ВИЧ-1 ТВ1 ВПЧ для инъекций», 1296-и.

8.Инструкция по изготовлению и контролю вакцины против ВИЧ-1\СПИД «КомбиВИЧвак» (лиофилизат для приготовления раствора для подкожного введения).

СПИСОК ИСПОЛЬЗОВАННЫХ СОКРАЩЕНИЙ ВИЧ/СПИД вирус иммунодефицита человека, синдром приобретенного иммунодефицита ВОЗ Всемирная Организация Здравоохранения ВПЧ вирусоподобная частица ГИСК Государственный институт стандартизации и контроля ДНК дезоксирибонуклеиновая кислота дсРНК двуспиральная рибонуклеиновая кислота ИФА иммуноферментный анализ М концентрация вещества, моль/л МЕ международная единица (измерение активности препарата) МНТЦ Международный научно-технический центр ОП оптическая плотность ПААГ полиакриламидный гель ФСП Фармакопейная статья предприятия СD антигенраспознающий Т-клеточный рецептор TNF Фактор некроза опухоли IFN Интерферон G-CSF Гранулоцитарный колониестимулирующий фактор GM-CSF Гранулоцитарномакрофагальный колониестимулирующий фактор В работу вошли результаты совместных исследований с Азаевым М.Ш., Акуловой Н.И., Бажаном С.И., Бабкиной И.Н., Белявской В.А., Булычевым Л.Е., Веремейко Т.А., Гилевой И.П., Гончаровой Е.П., Даниленко Е.Д., Ерошкиным А.М., Ильичевым А.А., Карпенко Л.И., Кашперовой Т.А., Масычевой В.И., Мирошниковым П.Н., Некрасовой Н. А., Непомнящих Т.С, Порываевой В.А., Пустошиловой Н.М., Рыжиковым А.Б., Рязанкиным И.А., Сизовым А.А., Сандахчиевым Л.С., Татьковым С.И., Тумановым Ю.В., Ужаченко Р.В., Щелкуновым С.Н. Автор выражает благодарность коллегам, принимавших участие в проведении данных исследований и внедрении их результатов.



 

Похожие работы:


 
2013 www.netess.ru - «Бесплатная библиотека авторефератов кандидатских и докторских диссертаций»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.