авторефераты диссертаций БЕСПЛАТНАЯ  БИБЛИОТЕКА

АВТОРЕФЕРАТЫ КАНДИДАТСКИХ, ДОКТОРСКИХ ДИССЕРТАЦИЙ

<< ГЛАВНАЯ
АГРОИНЖЕНЕРИЯ
АСТРОНОМИЯ
БЕЗОПАСНОСТЬ
БИОЛОГИЯ
ЗЕМЛЯ
ИНФОРМАТИКА
ИСКУССТВОВЕДЕНИЕ
ИСТОРИЯ
КУЛЬТУРОЛОГИЯ
МАШИНОСТРОЕНИЕ
МЕДИЦИНА
МЕТАЛЛУРГИЯ
МЕХАНИКА
ПЕДАГОГИКА
ПОЛИТИКА
ПРИБОРОСТРОЕНИЕ
ПРОДОВОЛЬСТВИЕ
ПСИХОЛОГИЯ
РАДИОТЕХНИКА
СЕЛЬСКОЕ ХОЗЯЙСТВО
СОЦИОЛОГИЯ
СТРОИТЕЛЬСТВО
ТЕХНИЧЕСКИЕ НАУКИ
ТРАНСПОРТ
ФАРМАЦЕВТИКА
ФИЗИКА
ФИЗИОЛОГИЯ
ФИЛОЛОГИЯ
ФИЛОСОФИЯ
ХИМИЯ
ЭКОНОМИКА
ЭЛЕКТРОТЕХНИКА
ЭНЕРГЕТИКА
ЮРИСПРУДЕНЦИЯ
ЯЗЫКОЗНАНИЕ
РАЗНОЕ
КОНТАКТЫ

Получение искусственных биокатализаторов на основе антител, способных осуществлять “ковалентный катализ”

МОСКОВСКИЙ ГОСУДАРСТВЕННЫЙ УНИВЕРСИТЕТ им. М.В. ЛОМОНОСОВА

На правах рукописи

Решетняк Андрей Васильевич ПОЛУЧЕНИЕ ИСКУССТВЕННЫХ БИОКАТАЛИЗАТОРОВ НА ОСНОВЕ АНТИТЕЛ, СПОСОБНЫХ ОСУЩЕСТВЛЯТЬ “КОВАЛЕНТНЫЙ КАТАЛИЗ” Специальность 02.00.10 – биоорганическая химия

АВТОРЕФЕРАТ

диссертации на соискание ученой степени кандидата химических наук

Москва 2007

Работа выполнена на кафедре химии природных соединений Химического факультета МГУ им. М.В.

Ломоносова и в лаборатории биокатализа Института биоорганической химии им. М.М. Шемякина и Ю.А. Овчинникова РАН.

Научные руководители: Член-корреспондент РАН, доктор химических наук, профессор Габибов Александр Габибович;

Кандидат биологических наук Пономаренко Наталья Александровна

Официальные оппоненты: Член-корреспондент РАН, доктор биологических наук, профессор Кочетков Сергей Николаевич Доктор химических наук, профессор, Румш Лев Давыдович

Ведущая организация: Институт биохимии им. А.Н.Баха РАН

Защита диссертации состоится 29 мая 2007 года, в 16:00 на заседании специализированного совета Д501.001.41 по химическим наукам при МГУ им. М.В. Ломоносова по адресу: 119992, Москва, Ленинские горы, д.1, стр.40, Институт физико-химической биологии им. А.Н.Белозерского МГУ им. М.В. Ломоносова, ауд. 501.

С диссертацией можно ознакомиться в библиотеке химического факультета Московского Государственного Университета им. М.В. Ломоносова.

Автореферат разослан 27 апреля 2007 года.

Ученый секретарь Диссертационного совета кандидат химических наук И.Г. Смирнова Актуальность проблемы.

«Ковалентный катализ» является одним из основополагающих механизмов, обеспечивающих уникальные свойства ферментов как наиболее эффективных биокатализаторов. Разработка путей создания искусственных ферментов, способных осуществлять ковалентный катализ, является актуальной задачей энзимологии, биохимии и молекулярной биологии. Решение такой задачи может помочь понять пути эволюции биокаталитических функций. Создание искусственных биокатализаторов может найти так же практическое применение в фармацевтике и биотехнологии. Стратегии их получения в последнее время расширились до функциональной селекции комбинаторных библиотек диверсифицированных белковых доменов. Лиганды, способные взаимодействовать с активным центром ферментов, в том числе аналоги переходных состояний реакции, конформационные ингибиторы и суицидальные субстраты/ингибиторы, были использованы для аффинного и ковалентного отбора функциональных молекул ферментов. Способность ферментов образовывать ковалентные комплексы с механизм-зависимыми ингибиторами позволяет проводить их отбор посредством нуклеофильных остатков, принимающих непосредственное участие в «ковалентном катализе». Эффективная дискриминация на основании такой функциональной реакционной способности имеет широкое применение для идентификации и селекции потенциальных биокатализаторов.

Каталитические антитела (абзимы) - новый тип неферментативных биокатализаторов представляют интерес как с точки зрения исследования структурно-функциональных закономерностей, обуславливающих их каталитическую функцию, так и с позиций исследования механизма биокатализа, в частности изучения кинетических закономерностей исследуемых превращений. Эта перспективная область науки развивается чрезвычайно бурно и сочетает в себе элементы иммунологии, энзимологии, молекулярной биологии, органической химии и генетической инженерии. Структурно-функциональный анализ искусственных биокатализаторов на основе антител может обеспечить пути познания «эволюционно совершенного» биокатализатора. Направленный дизайн каталитических антител поможет создать методологию получения биокатализаторов заданной специфичности. В настоящей работе сделана попытка получить антитела, с каталитической функцией используя механизм зависимые ингибиторы сериновых гидролаз в качестве специфических «ловушек» способных взаимодействовать с активными белковыми молекулами. В качестве источника каталитических антител были использованы три лини мышей MRL, NZB/NZW и SJL/J, являющихся моделями различных аутоиммунных заболеваний, а так же полусинтетическая библиотека генов иммуноглобулинов человека.

Цель и задачи исследования:

Целью настоящей работы являлось получение каталитических антител, способных осуществлять “ковалентный катализ” и гидролизовать амидную связь, а так же структурно функциональный анализ полученных антител. Для выполнения работы были сформулированы следующие задачи: 1) Провести реакционную иммунизацию аутоиммунных мышей линий MRL, SJL и NZB/NZW гаптеном LAEEEV-Phos, конъюгированным с белком KLH. Изучить специфичность и каталитическую активность полученных в результате иммунизации антител.

2)Осуществить химическую селекцию полусинтетической библиотеки вариабельных фрагментов генов иммуноглобулинов человека на биотинилированный п-нитрофенил 8-метил 8-азабицикло[3.2.1]октан фенилфосфонат (Bt-X). 3) Исследовать каталитическую активность рекомбинантных одноцепочечных антител и провести их структурно-функциональный анализ.

Научная новизна и практическая значимость работы.

В настоящей работе проведена реакционная иммунизация пептидил дифенил фосфонатом (LAEEE-VPhos). Впервые показано, что полученные поликлональные антитела обладают специфичностью по отношению к пептидному фрагменту «реакционного» гаптена и способны ковалентно взаимодействовать с фосфонатной составляющей, являющейся суицидальным ингибитором сериновых протеаз. Разработан метод получения специфичных искусственных биокатализаторов, основанный на иммунизации аутоиммунных модельных животных реакционно-способными гаптенами и получены их кинетические характеристики.



Проведена селекция полусинтетической библиотеки вариабельных фрагментов генов иммуноглобулинов человека на способность ковалентно взаимодействовать с суицидальным ингибитором сериновых гидролаз (п-нитрофенил 8-метил-8-азабицикло[3.2.1]октан фенилфосфонат). Получены рекомбинантные одноцепочечные фрагменты антител ковалентно взаимодействующие с необратимыми ингибиторами сериновых гидролаз. Определены аминокислотные остатки, участвующие в «ковалентном катализе». Показано, что отобранные рекомбинантные антитела могут осуществлять катализ гидролиза амидной связи.

Биокатализаторы иммуноглобулиновой природы могут быть применены для терапии различных заболеваний. Среди потенциальных мишеней каталитических антител можно назвать поверхностные белки вирионов, цитокины, различные патогены белковой природы.

Терапевтические средства на основе каталитических антител могут обладать рядом важных преимуществ, среди которых высокая специфичность связывания мишени и возможность длительного существования в кровотоке.

Кроме того, антитела, способные ковалентно взаимодействовать с токсичными фосфорорганическими соединениями, могут выступать в качестве специфических «каталитических акцепторов» или «ловушек» для фосфорорганических соединений отравляющих веществ (ОВ), и их аналогов. В течение многих лет предпринимаются попытки получить эффективные антидоты к этим отравляющим веществам. В их качестве может выступать ацетилхолинэстераза, однако гораздо эффективнее представляется использование антител, имитирующих способность фермента являться специфическими акцепторами этих соединений. Свойства антител делают их идеальным инструментом для дизайна диагностических агентов нового поколения, основанных на технологии рекомбинантной ДНК.

Публикация и апробация работы. По теме диссертации опубликованы 4 статьи. Результаты диссертации были представлены на 20-ом IUMBM Международном Конгрессе по биохимии и молекулярной биологии (Киото, 2006), XVIII зимней молодежной научной школе “Перспективные Направления Физико-химической Биологии и Биотехнологии” (Москва, 2006), Международной Конференции Биокатализ 2005 (С.-Петербург – Кижи – Валаам, 2005).

Структура и объем работы. Диссертация состоит из введения, обзора литературы, обсуждения результатов, экспериментальной части, выводов и списка цитируемой литературы.

Диссертация изложена на _ страницах и содержит рисунков и таблицы.

ОСНОВНОЕ СОДЕРЖАНИЕ РАБОТЫ

Для получения абзимов, обладающих повышенными нуклеофильными свойствами, были использованы механизм-зависимые ингибиторы сериновых гидролаз. Их главным свойством является мимикрия стабильного переходного состояния реакции и образование ковалентной связи ингибитор–фермент. Существует большое число ингибиторов сериновых гидролаз, образующих стабильные ковалентные комплексы по типу ацил-фермент. Одним из первых и хорошо изученных необратимых ингибиторов сериновых гидролаз является диизопропилфторфосфонат (ДФП). Пептидил фосфонаты и фтор фосфонаты являются производными ДФП и изучались весьма интенсивно. Для получения каталитических антител механизм-зависимые ингибиторы на основе фосфонатов могут быть использованы в двух направлениях: 1) реакционная иммунизация и 2) реакционная селекция.

ИНДУКЦИЯ ЭПИТОП-СПЕЦИФИЧЕСКОГО КАТАЛИТИЧЕСКОГО ОТВЕТА МЕТОДОМ «РЕАКЦИОННОЙ ИММУНИЗАЦИИ».

Суть метода «реакционной иммунизации» заключается в индукции антител, которые в отличие от «традиционных» связываются с гаптеном ковалентно. Это связывание обусловливается химическими реакциями, которые протекают между антителом и химически активным гаптеном. Выбор активного гаптена определяет тип реакции, протекающей между ним и взаимодействующим антителом, и, следовательно, тип катализируемой антителом реакции. Образование ковалентного интермедиата с фтор производными фосфонатов было показано для каталитических эстеролитических антител 17Е8 (Zhou, Guo et al. 1994;

Guo, Huang et al. 1995) и 9А8 (Kolesnikov, Kozyr et al. 2000). Эти факты позволяют утверждать, что ковалентный каталитический аппарат сериновых гидролаз в абзимах может быть воспроизведен. Для получения специфического абзима методом реакционной иммунизации необходимо, чтобы гаптен представлял собой структуру, «голова» которой содержит механизм зависимый ингибитор протеазы, а «хвост» – пептидильную цепь, соответствующую по длине участку, взаимодействующему в активном центре фермента. В качестве полипептидныой цепи была выбрана небольшая последовательность Leu-Ala-Glu-Glu-Glu-Val, соответствующая аминокислотным остаткам 265-270 гликопротеина вируса иммунодефицита человека 1 (ВИЧ-1) – gp120. Ранее было показанно (Pollard, Meier et al. 1991), что специфичное расщепление по этому сайту приводит к тому, что gp120 теряет свою способность связываться с рецептором CD4, что не позволяет вирусу инфецировать CD4+ клетки. Данный пептид был модифицирован по С-концевой аминокислоте группой механизм-зависимого ингибитора – дифенил фосфонатом. Такой пептид относится к пептидил -аминоалкилфосфонатам. Схема его синтеза и структура представлены на рисунке 1. Необходимо отметить, что важным свойством выбранного гаптена является низкая неспецифическая реакционная способность и высокая стабильность в водных растворах.





Рисунок 1. Схема синтеза пептидил фосфоната – LAEEEV-Phos.

На первом этапе был синтезирован защищенный по свободной аминогруппе дифенил 1-(N бензилоксикарбонил)-аминоалкилфосфонат в реакции соконденсации трифенилфосфита, изобутаналя и бензилкарбамата (рис. 1). Защитную группу удаляли, выделенный дифенил-4 аминоалкилфосфонат анализировали и использовали для дальнейшей работы. Методами элементного анализа и ПМР-спектроскопии было показано, что полученный на данном этапе дифенилвалилфосфонат является аналогом соответствующей аминокислоты с заменой карбоксильной группы на дифенилфосфонат.

Синтез защищенного по N-концевой аминогруппе и боковым группам пептида Boc-Val Ala-(t-Bu)Glu-(t-Bu)Glu-(t-Bu)Glu проводили по стандартной процедуре для Boc-производных аминокислот. Защитные группы были выбраны таким образом, чтобы условия деблокирования не привели к деградации фосфонатной группы. Последующая конденсация полученного пептида с фосфонатным производным валина была произведена путем активации свободной карбоксильной группы дициклогексилкарбодиимидом. Очистку пептидил дифенил фосфоната проводили методом обращенно-фазовой ВЭЖХ в возрастающем градиенте ацетонитрила и анализировали методом масс-спектрометрии (MALDI-TOF). Снятие защитных групп проводили 100%-ной трифторуксусной кислотой. Полученный таким образом пептидилфосфонат не требовал дополнительной очистки и после преципитации был использован на следующих этапах работы.

Поскольку известно, что малые молекулы в большинстве случаев являются слабыми иммуногенами, для проведения эффективной иммунизации синтезированные реакционные пептиды были конъюгированы с KLH. Для присоединения N-концевой аминогруппы пептида к доступным аминогруппам KLH был выбран метод с предварительной активацией носителя при помощи бис[сулфосукцинимидилсуберата] (BS3, Pierce) и последующим присоединением гаптена. Для эффективной детекции каталитических антител N-конец синтезированного пептидил фосфоната был модифицирован активированным эффиром биотина.

Природные каталитические антитела (ДНК гидролизующие и протеолитические) часто обнаруживают при различных аутоиммунных патологиях человека и у модельных животных (Shuster, Gololobov et al. 1992;

Paul, Volle et al. 1989;

Ponomarenko, Durova et al. 2002). Было также показано, что при иммунизации аналогом переходного состояния мышей линий SJL и MRL/lpr частота появления гидролитических абзимов значительно выше, чем в случае контрольной линии Balb/c (Tawfik, Chap et al. 1995). Поэтому для получения эпитоп специфических абзимов использовали три линии мышей: MRL/lpr, NZB/NZW F1 и SJL – являющихся моделями различных аутоиммунных заболеваний.

Иммунизацию мышей данных линий проводили по ранее опубликованной схеме получения каталитических антител к аналогам переходного состояния ферментативных реакций (Tawfik, Chap et al. 1995). Сравнительный анализ специфического иммунного ответа на антиген у разных иммунизированных мышей всех трех линий проводили методом иммуноферментного анализа (ELISA). В качестве антигена был использован исходный пептидилфосфонат, меченный биотином;

биотинилированный Val-фосфонат и нитрофенилметил-п биотинилфенилметилфосфонат, для которого ранее была показана специфическая ковалентная модификация активного центра абзимов (Kolesnikov, Kozyr et al. 2000) ** ** ** ** ** ** (рис. 2). Антитела всех трех линий иммунизированных мышей обладают высокой специфичностью к модифицированному пептидному фрагменту антигена, не взаимодействуют в условиях данного Рисунок 2. Иммуноферментный анализ сывороток мышей линий SJL, MRL и NZB/NZW F1, иммунизированных эксперимента со свободным Val пептидилфосфонатом. Сыворотки крови адсорбировали на иммунопланшетах, с иммобилизованными козьими фосфонатом, в то же время антителами к Fc фрагменту антител мыши, инкубировали с соответствующим антигеном и проявку вели при помощи связываются с более активным и менее стрептавидина, конъюгированного с пероксидазой хрена.

специфичным модифицирующим агентом (Метил-p-нитрофенил биотинилфенил метилфосфонат). Важно отметить, что в среднем у новозеландских гибридов количество антиген-специфических антител было несколько выше по сравнению с двумя другими аутоиммунными линиями, в то время как антитела мышей линии MRL обладали наибольшей аффиностью по отношению к метил-p-нитрофенил биотинилфенил метилфосфонату.

Дальнейшее изучение типа взаимодействия полученных антител с реакционным пептидом проводилось на аффинно очищенных препаратах IgG. Иммобилизованный на мембране ковалентный комплекс антиген–антитело детектировали методом иммуноблоттинга. Результаты данного эксперимента, представленные на рисунке 3, свидетельствуют о наличии в препаратах поликлональных антител, выделенных из аутоиммунных мышей, иммунизированных «реакционным» пептидом Leu-Ala-Glu-Glu-Glu-Val-PO(OPh)2, как легких, так и тяжелых цепей иммуноглобулинов, способных к ковалентной модификации пептидом. Т.е. в результате реакционной иммунизации образовались антитела,способные ковалентно взаимодействовать с гаптеном и строго специфичным к его пептидной компоненте.

NZB/NZW NZB/NZW трипсин трипсин BALB/c BALB/c MRL БСА MRL БСА SJL SJL - - иммун.

+ - - иммун.

+ контроль LAEEEVPhos контроль LAEEEVPhos 116 66 Hc Hc 45 35 Lc Lc 25 18 электрофореграмма стрептавидин- HRP Рисунок 3. Электрофореграмма и иммуноблоттинг поликлональных антител (1 мкг), выделенных из иммунизированных мышей линий SJL, MRL и NZB/NZW F1, после реакции пептидил фосфонатом - LAEEEV-Phos (0,1 мкМ). Трипсин (1 мкг), БСА (5 мкг) и поликлональные IgG, выделенные из мыши линии BALB/c (1 мкг) были использованы в качестве положительного и отрицательного контролей соответственно.

В результате скрининга панели гибридом, полученных из селезенок опытных мышей, были отобраны 7 моноклональных антител, способных к ковалентной модификации реакционным пептидил фосфонатом. Причем в двух случаях модификации подвергались легкие цепи антител, а в пяти – тяжелые.

ДНК, соответствующая вариабельным доменам данных антител, была наработана методом ПЦР, и определена их нуклеотидная последовательность. Одноцепочечные антитела были экспрессированны в прокариотической системе. Рекомбинантные антитела Е11 и Е6 обладали каталитической активностью по отношению к низкомолекулярному субстрату LAEEEV-MCA.

Кинетические параметры гидролиза амидной связи составили kcat = 1,1 ± 0,5 x 10-3 min-1, Km = ±14 мкM для антитела Е6 и kcat =3,2 ± 0,7 x 10-4 min-1, Km = 48 ±11 мкM для антитела Е11.

Проведенные эксперименты показали принципиальную возможность получения специфичных к антигену каталитических антител методом реакционной иммунизации.

РЕАКЦИОННАЯ СЕЛЕКЦИЯ АНТИТЕЛ ИЗ СИНТЕТИЧЕСКОЙ БИБЛИОТЕКИ ГЕНОВ ИММУНОГЛОБУЛИНОВ ЧЕЛОВЕКА.

Механизм-зависимая селекция комбинаторных библиотек является эффективным инструментом для получения новых биокатализаторов. Использование необратимых ингибиторов позволяет проводить селекцию по способности активных биокатализаторов образовывать с ними ковалентные комплексы. Отбор по ковалентному взаимодействию имеет ряд преимуществ и позволяет применять весьма жесткие условия селекции. Более того, условия реакции и выбор реагента могут изменяться для достижения кинетической или термодинамической селективности. На сегодняшний день примеры химической селекции в применении к фаговому дисплею антител были в основном сфокусированы на нековалентном связывании с аналогами переходного состояния или на ковалентной реакционной способности суициидальных субстратов.

В работе была использована полусинтетическая библиотека сегментов вариабельных фрагментов геннов иммуноглобулинов человека Griffin.1 (MRC, Center for proteing engineering, UK). Библиотека была построена на основе зародышевых линий 49 сегментов вариабельных регионов тяжелых цепей, а так же 26 и 21 сегмента вариабельных регионов и легких цепей соответственно. Третий гипервариабельный участок как тяжелых, так и легких цепей был рандоменизирован методом ПЦР (Griffiths, Williams et al. 1994). Гены вырожденных одноцепочечеых антител (ScFv) были проклонированы в фагемидный вектор pHEN2.

Представительность библиотеки составляет 1,2х109. Схематически библиотека Griffin. представлена на рисунке 4.

Риунок 4. А – создание синтетического репертуара тяжелых и легких цепей (Griffiths, Williams et al. 1994). Б – карта библиотеки, построенной на основе вектора pHEN2 и синтетического репертуара сегментов генов иммуноглобулинов человека.

Для проведения химической селекции и скрининга были использованы п-нитрофенил 8 метил-8-азабицикло[3.2.1]октан фенилфосфонат (Х) и его биотинилированный аналог (Bt-X) (рис. 5).

O H А Б N H3C O H + NH N H3C NH O + N NH PO O S O PO O O NO X Bt-X NO Рисунок 5. Структура п-нитрофенил 8-метил-8-азабицикло[3.2.1]октан фенилфосфоната (А) и его биотинилированного аналога (Б).

Данный фосфонат был разработан как ингибитор сериновых гидролаз (Tramontano, Ivanov et al. 2000), и ранее был использован для детекции протеолитической активности у природных антител при различных аутоиммунных нарушениях (Paul, Tramontano et al. 2001). Благодаря п нитрофенильной группе он является весьма реакционно способным по отношению к сериновым гидролазам. В отличие от фтор производных фосфонатов устойчив в водных растворах и не проявляет неспецифической реакционноспособности по отношению к инертным белкам.

Для селекции активных фаговых антител, способных ковалентно взаимодействовать с фосфонатом Bt-X, была использована следующая схема:

1. Реакцию фаговых частиц с биотинилированным фосфонатом проводили в растворе. Для достижения специфичности реакции варьировали концентрацию фосфоната Bt-X (от до 1 мкМ) и температуру реакции (комнатная температура – 22оС и 37оС).

2. Избытка биотинилированного фосфоната удаляля двухкратным переосаждения фаговых частиц раствором ПЭГ/NaCl.

3. Адсорбцию фаговых частиц проводили в лунках с иммобилизованным стрептавидином, предварительно проинкубированных с раствором БСА. Для оценки специфичности селекции в качестве отрицательного контроля использовали лунки, так же, предварительно прединкубированные раствором БСА и биотина.

4. Для удаления неспецифической сорбции лунки промывали нейтральным буфереом ФБС, содержащим Твин, и кислым Трис-глициновым буфером (рН 2,7).

5. Элюцию фаговых частиц проводили раствором трипсина.

6. Наличие полноразмерных вставок генов одноцепочечных антител проверяли методом ПЦР. Для оценки специфичности селекции сравнивали титр фаговых частиц, полученных при элюции из экспериментальных и контрольных планшетов.

7. Фаговые частицы, показавшие хорошее соотношение титра экспериментальных фагов к контрольным и высокий процент полноразмерных вставок, использовали для амплификации и дальнейших раундов селекции.

По описанной выше схеме были проведены три раунда селекции. После третьего раунда селекции поликлональные одноцепочечные антитела (ScFv) были проэкспрессированны в клетках HB2151. Растворимые ScFv были выделены из периплазматической фракции методом метолло-хелатной хроматографии с использованием сорбента Ni-NTA. Полученные рекомбинантные антитела были использованы для реакции с Bt-X. Продукты реакции разделяли в полиакриламидном геле (ПААГ) и детектировали методом иммуноблоттинга с использованием стрептавидина, коньюгированного с пероксидазой хрена. Наличие рекомбинантных ScFv, контролировали гибридизацией с моноклональными антителами к 6хHis тэгу(рис. 6).

стрептавидин-HRP анти-6xHis-HRP В отличие от отбраных после третьего 123456 1 2 3 4 PMW раунда селекции, контрольное рекомбинантное одноцепочечное антитело к тиреоглобулину не взаимодействовало с Bt-X, что свидетельствует оспецифичности ковалентной модификации.

Полученные результаты позволили сделать вывод о том, что селекция прошла успешно, и поликлональные антитела, полученные после Рисунок 6. Иммуноблоттинг поликлональных третьего раунда, способны ковалентно ScFv после реакции с Bt-X. Дорожка 1 пулированных клонов, отобранных после взаимодействовать с Bt-X фосфонатом. Кроме третьего раунда селекции;

2 общий пулл клонов, отобранных после третьего раунда того, селекция позволила существенно селекции;

3 общий пулл клонов, отбранных п о с л е вто р о го р ау н д а с ел е к ц и и ;

повысить уровень экспрессии растворимых отрицательный контроль рекомбинантное антитело к тиреоглобулину;

поликлональных антител.

неселектированная библиотека Griffin.1;

6 0, мкг трипсина. Проявку иммуноблотинга Девяносто шесть клонов после третьего осуществляли стрептавидином, коньюгированным с пероксидазой хрена или раунда селекции были выбраны для моноклональными антителами к 6xHis эпитопу, коньюгированными с пероксидазой хрена.

дальнейшего изучения. Клоны показавшие в ПЦР анализе наличие полноразмерного фрагмента одноцепочечных антител, были использованы для экспрессии. Периплазматическая фракция была выделена для каждого индивидуального клона и была использована в реакции с Bt-X фосфонатом. Реакционные смеси были проанализированы методом иммуноблоттинга. 11 ScFv были отбраны на основании специфического мечения ScFv полосы в области 28 кДа (детекцию вели при помощи стрептавидина, конъюгированного с пераксидазой хрена) и эффективной экспрессии. рекомбинантных антител не способных к ковалентной модификации, но показавших хороший уровень экспрессии, были выделены методом металло-хелатной хроматографии и после рекции с биотинилированным фосфонатом использованы для иммуноферментного анализа ELISA.

Связывание с антигеном оценивали по сравнению с антителом из неселектированной библиотеки, антителом, связывающем тиреоглобулин и двумя антителами, способными взаимодействовать с Bt-X ковалентно. Данные ИФА анлиза приведены на рисунке 7.

В результате трех раундов селекции из библиотеки были отобраны хорошо экспрессирующиеся растворимые одноцепочечные антитела, способные взаимодействовать с Bt-X фосфонатом либо ковалентно, либо нековалентно.

Нуклеотидная последовательность была определена для всех отбранных ScFv. На основании сравнения их первичных последовательностей были выделены 8 (из 11) уникальных «реакционных» Рисунок 7. Иммуно ферментный анализ ScFv, после клонов (способных реакции с Bt-X. Адсорбцию ScFv проводили в лунках с иммобилизованным стрептавидином, предварительно взаимодействовать с Bt-X проинкубированных с раствором БСА. Детекцию комплекса ScFv - Bt-X проводили при помощи фосфонатом ковалентно) и 6 (из 7) стрептавидина, конъюгированного с пероксидазой хрена.

S.1, S3, S7, S9, S11, S14, S17 рекомбинантные антитела, связывающих клонов. Зародышевые отобраные после третьего раунда не способные взаимодействовать с Bt-X ковалентно. N ScFv из линии и семейства тяжелых и легких н е с ел е к т ир о в а н н о й б и бл и от е к и, a n t i - Ty r F v одноцепочечное антитело к тиреоглобулину, Bt-X биотинилированный фосфонат инкубировали с цепей всех отобранных антител реакционным буффером и наносили на иммунопланшет.

A.5 и A.17 ScFv отобраные после третьего раунда приведены в таблице 1.

взаимодействующие с фосфонатом ковалентно.

Таблица 1.

Легкая цепь Тяжелая цепь Кол-во Клон Семейс копий Сегмент CDR3 * Сегмент CDR Семейство тво Связывающие клоны S.1 DPL-3 AAWDDSLV VH1 DP-14 NLNVVDS V S.3 DPL-3 AAWDDSLGA VH3 DP-45# ESGAPDS V S.7 DPL-3 AAWDDSLQG VH1 DP-7 DHLGAGG V S.9 DPL-16 NSRDSSGY VH4 DP-67 RVRDRVL V VH3/ DP-47/ S.11 DPL-2 AAWDDSLSAP STEGEQS V VH4 DP- S.14 DPL-3 AAWDDSLLSP VH1 DP-10 MYDMQKS V Реакционные клоны A.1 DPL-3 AAWDDSLDAF VH4 DP-66 FDAPNTRA V A.46 DPL-3 AAWDDSLFSP VH4 DP-66 FGGQQVP V A.5 DPL-3 AAWDDSLGT VH4 DP-65 FGTRGNTH V A.43 DPL-3 AAWDDSLSAL VH4 DP-65 WMDNT V A.7 DPL-3 AAWDDSLGGP VH4 DP-71 FGGQQVP V A.49 DPL-3 AAWDDSLGT VH4 DP-71 HEGPLSAAQ V A.21 DPL-3 AAWDDSLRSP VH1 DP-3 DREL V A.17 DPL-5 GTWDSSLNP VH4 DP-67 LTQSSHNDAN V * AAWDDSL, GTWDSSL, NSRDSSG Указанные последовательности не варьировались в библиотеке Griffin.1.

Легкие цепи всех отобранных ScFv, как связывающих, так и реакционных, за исключением S.9, принадлежат к V1 семейству, причем DPL-3 сегмент является наиболее распространенным. VH4 и VH1 семейства тяжелых цепей встречаются наиболее часто среди связывающих клонов, однако VH4 является основным семейством среди реакционных клонов (только A.21 относится к VH1 семейству). Для связывания с Bt-X фосфонатом необходимо наличае либо V1 DPL3, либо VH4 DP-67 сегментов антител, при этом для ковалентного взаимодействия комбинация DPL3 сегмента и VH4 семейства является предпочтительной, исключения составляют только A.17 и A.21. Легкая цепь антитела A.17 относится к V семейству, DPL5 сегменту, а тяжелая - к VH4, DP-67. DPL5 и DPL3 являются очень близкими сегментами, и между ними просматривается высокая степень гомологии. Весьма интересно, что сегмент DP-67 представлен только в одном «реакционном» клоне (A.17), однако он является одним из основных сегментов среди связывающих антител, причем только в случае DP- сегмент легкой цепи может быть изменен с DPL3 на другой сегмент или даже семейство.

Антитело A.21 относится к V1 и VH1 семействам и к DPL3 и DP-3 сегментам. Оно имеет высокую гомологию с S.1;

S.7 и S.14 связывающими ScFv, однако третий гипервариабельный регион антитела A.21 сильно отличается от гипервариабельных регионов связывающих антител.

Третий гипервариабельный регион тяжелых цепей реакционных клонов имеет некий консервативный консенсус, а последовательность FGGQQVP встречается в двух различных клонах (в четырех, принимая во внимание количество копий одного и того же клона). Из чего можно сделать предположение, что, по всей видимости, третий гипервариабельный регион тяжелых цепей принимает непосредственное участие в «ковалентном катализе».

Все «реакционные» клоны были охарактеризованы по кинетике взаимодействия с небиотинилированным фосфонатом Х. Детекцию протекания реакции во времени проводили спектрофотометрически по образующемуся окрашенному продукту (п-нитрофенолу). Кинетику взаимодействия ферментов с необратимыми ингибиторами, как правило, описывают в виде двух стадийного процесса: 1) образование обратимого нековалентного комплекса фермент-ингибитор и 2) более медленный процесс образования ковалентной связи между ингибитором и ферментом (Kitz and Wilson 1962). Схематически этот процесс можно изобразить в виде:

k1 k E+I EI E-I k-1 обратимый ковалентный комплекс комплекс Типичные кинетические кривые реакции антител с фосфонатом Х приведены на рисунке 8.

на примере одноцепочечного антитела А.17.

Рисунок 8. Кинетические кривые реакции 18 мкМ A.17 с различным количеством фосфоната Х. Врезка – лианеризация кинетических кривых в соответствии со схемой Китца – Уилсона.

Таблица 2. Кинетические параметры реакции ScFv с фосфонатом Х.

k2/Kдис, М-1мин- Клон k2, 1/мин Kдис, мкM А.17 0,32±0,005 151±21 А.5 0,035±0,002 35±23 А.21 0,032±0,005 71±18 А.43 0,017±0,004 81±43 А.46 0,021±0,004 89±49,1 А.49 0,012±0,004 56±14 А.7 0,037±0,003 213±86 В таблице 2 приведены кинетические характеристики для всех реакционных ScFv.

Сравнивая кинетические параметры различных антител, можно заметить, что константа скорости первого порядка k2, являющаяся основной характеристикой скорость-лимитирующего процесса, образования ковалентной связи, варьируется в очень узком диапазоне (от 0,012 мин- до 0,037 мин-1) для большинства антител. Однако одно из антител (А.17) оказалось практически на порядок более реакционно способным (k2=0,32 мин-1). Константа диссоциации так же варьировалась в довольно узком диапазоне (от 35 до 200 мкМ). Полученные данные можно сравнить с опубликованными ранее результатами по реакции фосфоната Х с сериновыми гидролазами (Tramontano, Ivanov et al. 2000). Значения констант скорости составляли 1800;

и 4100 М-1мин-1 для реакции бутирилхолинэстеразы, химотрипсина и трипсина с фосфонатом Х соответственно. Т.е., наиболее активное антитело А.17 обладает реакционной способностью, сравнимой с таковой для природных сериновых гидролаз.

Реакция А.17 с Bt-X фосфонатом ингибировалась прединкубацией с ингибиторами сериновых протеаз, такими как аминоэтилбензенсульфонил фторидом (AEBSF) и аналогами валина и фенилаланина карбоксильная группа, которых заменена на дифенил фосфонат. В то же время прединкубация с более активными фтор фосфонатами, такими как зарин и кумаринил этил п трифторацетамидофенилметилфосфонат, не приводили к ингибированию реакции фосфорилирования А.17 Bt-X (рис.

9). Что свидетельствует о специфичности активного центра, отобранного в результате селекции на Bt-X фосфонат.

Протекание реакции между реакционным фосфонатом и Рисунок 9. Иммунодетекция антителами было также подтверждено при помощи прямого реакций антитела А.17 с механизм зависимыми ингибиторами метода масс-спектрометрии SELDI (данные не приводятся).

сериновых протеаз. А.17 (1 мкМ) о инкубировали 1ч на 37 С с 5мМ Было показано, что в результате реакции одноцепочечных AEBSF (дорожка 1), 5мМ валил фосфоната (дорожка 2), 5мМ антител с биотинилированным фосфонатом происходит фенилаланин фосфоната (дорожка 3), с 100 мкМ зарина (дорожка 4), увеличение массы антител, соответствующее ровно одному 100 мкМ кумаринил этил п трифторацетамидофенилметилфо остатку фосфоната.

сфоната (дорожка 5), 100 мкМ Х (дорожка 6) и с ФБС буфером Для определения нуклеофильного остатка, (дорожка 7). Затем все образцы о инкубировали 1ч при 37 С со 100 участвующего в ковалентном катализе, наиболее активное мкМ Bt-Х, разделяли в ПААГ и использовали для антитело А.17 было промодифицировано и м м у н о бл от т и н га. П р о я в к у иммуноблотинга осуществляли биотинилированным фосфонатом Bt-X. Модифицированное и стрептавидином, коньюгированным с пероксидазой контрольное антитело было подвержено исчерпывающему хрена.

трипсинолизу, и триптический гидролизат был проанализирован методом масс-спектрометрии SELDI (рис. 10) Рисунок 10. SELDI масс-спектр триптического гидролизата одноцепочечного антитела А.17 (верхний спектр) и антитела А.17, модифицированного Bt-X фосфонатом (нижний спектр).

Полученные данные были проанализированы при помощи программы GPMAW 7.01.

Молекулярная масса каждого пика была соотнесена с пептидами, образующимися в результате гидролиза одноцепочечного антитела А.17 трипсином (таб. 3).

Модификации Bt-X фосфонатом подвергается пептид одноцепочечного антитела 152 – VTISCSGSSSNIGNNYVSWYQQLPGTAPK. Данный пептид соответствует первому гипервариабельному региону легкой цепи и фланкирующим его первому и второму каркасным участкам. Модифицированный пептид был дополнительно очищен методом аффинной хроматографии с использованием стрептавидин-сефарозы и подвержен тандемной масс спектрометрии. МС/МС анализ показал, что ковалентной модификации подвергается Tyr легкой цепи (данные не приводятся). Для подтверждения данных, полученных методом тандемной масс-спектрометрии, модифицированный пептид 152 – 180 антитела А. гидролизовали химиотрипсином, и полученный образец анализировали методом прямой масс спектрометрии. Было показано, что в результате гидролиза химотрипсином пептида 152 – образуются два основных продукта:

- VTISCSGSSSNIGNNYVSW (MW = 2032,0 Да) и YQQLPGTAPK+phosph (MW = 1748,1 Да).

Таблица 3.

SELDI От MW ** Последовательность пептидов заряд MW до теор.

1873 181- 196 +1 1872, LLIYDNNKRPSGIPDR 2124 240-259 +1 2123, LTVLGAAAHHHHHHGAAEQK 2374 45-65 +1 2373, GLEWIGSIYHSGSTYYNPSLK 3060 152-180 +1 3059, VTISCSGSSSNIGNNYVSWYQQLPGTAPK 152-180 VTISCSGSSSNIGNNYVSWYQQLPGTAPK* 3443 +2 6886, SGTSATLGITGLQTGDEADYYCGTWDSSLNPVFGGGTK* 202- 3827 202-239 +1 3828, SGTSATLGITGLQTGDEADYYCGTWDSSLNPVFGGGTK После модификации 3704 152-180 +1 3706, (VTISCSGSSSNIGNNYVSWYQQLPGTAPK)-Bt-X 152-180 (VTISCSGSSSNIGNNYVSWYQQLPGTAPK)-Bt-X* 3767 +2 SGTSATLGITGLQTGDEADYYCGTWDSSLNPVFGGGTK* 7533, 202- *Цистеины, выделенные жирным шрифтом, образуют дисульфидную связь.

** приведенны средние молекулярные массы.

Аналогичным образом для одноцепочечного антитела А.7, было показано, что Tyr является нуклеофильным остатком, участвующем в «ковалентном катализе». Для других антител удалось получить МС/МС спектр непосредственно методом тандемной масс спектрометрии, не выделяя меченый пептид из гидролитической смеси пептидов. Для модификации «реакционных» антител был использован небиотинилированный фосфонат Х.

Интересно отметить, что Tyr36, расположенный во втором каркасном регионе легкой цепи, является нуклеофильным остатком только в случае наиболее активного антитела А.17, во всех остальных случаях Tyr32, расположенный в первом гипервариабельном регионе легкой цепи, принимает участие в «ковалентном катализе». Тирозины 32 и 36 являются весьма консервативными аминокислотными остатками в белках иммуноглобулиновой природы.

Одним из преимуществ работы с рекомбинантными антителами является возможность быстрого осуществления сайт направленного мутагенеза. Для подтверждения масс спектрометрических данных тирозины 32 и 36 легкой цепи были заменены на фенилаланин в двух наиболее активных клонах – А.17 и А.5. Фенилаланин является полным аналогом тирозина, но не содержит гидроксильную группу, способную принимать участие в «ковалентном катализе». Поэтому замена тирозина на фенилаланин не должна сказаться на структуре антител, но должна кардинальным образом повлиять на их каталитические свойства.

Кроме того, тирозин 36 антитела А.17 был заменен на серин. Серин, так же как и тирозин, содержит гидроксильную группу, способную выступать в качестве нуклеофила при ковалентном катализе, однако расположение гидроксильной группы в третичной структуре белка сильно различается в случае тирозина и серина. Интересно исследовать, каким образом скажется на активности замена тирозинового остатка на сериновый.

Антитела А.17 и А.5 и их мутанты были проэкспрессированы, концентрация рекомбинантных антител была пронормирована. Полученные препараты были использованы в реакции с Bt-X фосфонатом. В качестве отрицательного контроля было использовано одноцепочечное антитело к тиреоглобулину. Детекцию протекания реакции вели методом иммуноблоттинга (рис. 11).

Замена тирозина 32 на Y3 6 F, 6S F 17 6F фенилаланин приводит к 6F 2F А. Y А. Y Y Y Y полной потере активности по.

.

нт нт -к о -к о А.

А.

А.

А.

А.

А.

отношению к Bt-X фосфонату в случае антитела А.5, однако стрептавидин это практически не влияет на HRP активность антитела А.17. При этом замена тирозина 36 на анти-myc фенилаланин приводит к прямо антитела противоположному результату - активность антитела А.5Y36F Рисунок 11. Иммуноблоттинг реакционной смеси антител А.17 и А.5 и их мутантов с биотинилированным фосфонатом Bt-X.

сохраняется на том же уровне, Верхний рисунок проявку проводили стрептавидином, конъюгированным с пероксидазой хрена;

нижняя что и активность антитела моноклональными антителами к c-Myc эпитопу.

дикого типа. Мутанты А.17Y36F и A.17Y32,36F оказываются неактивными в реакции с фосфонатом. Неактивным оказался так же и мутант ScFv A.17, сожержащий замену тирозина на серин. Таким образом, результаты мутагенеза двух «реакционных» антител полностью подтвердили масс-спектрометрические исследования. Было также показано, что в случае антитела А.17 важно не только наличие аминокислотного остатка, содержащего гидроксильную группу в положении 36 легкой цепи, но и расположение этой гидроксильной группы в активном центре.

А.17, как наиболее реакционно способный, был проверен на амидазную активность на небольшой библиотеке метилкумарин амидных субстратов. После трех стадийной очистки одноцепочечное антитело не катализировало гидролиз типичных трипсиновых субстратов Pro Phe-Arg-MCA или Boc-Gly-Gly-Arg-MCA. Однако при этом наблюдалось ускорение гидролиза двух гидрофобных субстратов (Phe-MCA и Boc-Ala-Ala-Phe-MCA). Амидазная активность отсутствовала в препарате мутированного антитела A.17Y36F и ингибировалась в результате прединкубации А.17 с фосфонатом X. Амидазная активность А.17 так же исчезала в результате иммуноадсорбции антителами к с-myc эпитопу, иммобилизованными на агарозу. Гидролиз субстрата Phe-MCA, рекомбинантным одноцепочечным антителом А.17 подчиняется кинетической схеме Михаэлиса-Ментен (kcat = 2,1 ± 0,8 x 10-4 min-1, Km = 47 ±12 мкM).

Заключение В описанном выше исследовании химическая селекция была применена для поиска белковых молекул, проявляющих ковалентную реакционную способность - химическую особенность, являющуюся универсальной для катализа. Сайт связывания одноцепочечных антител был использован в качестве матрицы, лишенной химического аппарата, для каталитической функции. Химические свойства и понимание структуры полученных «реакционных» молекул могут пролить свет на понимание основных элементов природных и искусственных ферментов.

Одноцепочечные антитела, полученные в этой работе, могут быть рассмотрены как пример простейшего устройства активного центра ферментов и использованы в качестве матрицы для получения новых искусственных ферментов методом целенаправленного улучшения их свойств (directed enzyme evolution).

ВЫВОДЫ:

1. Показана принципиальная возможность получения методом реакционной иммунизации каталитических антител, способных специфично ковалентно взаимодействовать с пептидил дифенил фосфонатом.

2. В результате реакционной селекции фаг-дисплейной библиотеки получены рекомбинантные антитела, способные осуществлять «ковалентный катализ».

3. Проведен структурно-функциональный анализ полученных рекомбинантных антител.

Показано, что для ковалентного взаимодействия с реакционным фосфонатом необходимо наличие V1 и VH4 семейств зародышевых линий легкой и тяжелой цепей антител соответственно.

4. Методом масс-спектрометрии определены аминокислотные остатки, проявляющие нуклеофильные свойства при ковалентном катализе. Показана роль данных остатков в ковалентном катализе при помощи сайт направленного мутагенеза.

5. Исследована кинетика модификации одноцепочечных антител реакционным фосфонатом. Оценены кинетические параметры реакции амидолиза, катализируемой антителом А.17.

Список работ, опубликованных по теме диссертации:

1. А.Г. Габибов, А. Фрибуле, Д. Тома, А.В. Демин, Н.А. Пономаренко, И.И. Воробьев, Д.

Пиле, М. Паон, Е.С. Александрова, Г.Б. Телегин, А.В. Решетняк, О.В. Григорьева, Н.В.

Гнучев, К.А. Малышкин, Д.Д. Генкин (2002) Антитела – протеазы: подходы к индукции каталитического ответа. Биохимия, 67, 1413-1426.

2. И.И. Воробьев, Н.А. Пономаренко, А.В. Решетняк, О.М. Дурова, В.К. Мисиков, С.В.

Сучков, А.Г. Габибов. (2004) Каталитические антитела в медицине: специфическая деградация аутоантигенов и новые подходы к инактивации патогенов. Молекулярная медицина 3, 48-55.

3. Ponomarenko NA, Vorobiev II, Alexandrova ES, Reshetnyak AV, Telegin GB, Khaidukov SV, Avalle B, Karavanov A, Morse HC 3rd, Thomas D, Friboulet A, Gabibov AG. (2006) Induction of a protein-targeted catalytic response in autoimmune prone mice: antibody-mediated cleavage of HIV-1 glycoprotein GP120. Biochemistry, 45, 324-30.

4. Решетняк А.В., Арментано М.Ф., Морзе Г.С., Фрибуле А., Маккер С.П., Трамонтано А., Кнорре В.Д., Габибов А.Г. и Пономаренко Н.А. (2007) Механизм-зависимая селекция библиотек генов иммуноглобулинов для получения ковалентных биокатализаторов.

Доклады Академии Наук, т. 415, н. 268-270.

5. Reshetnyak A.V., Armentano M.F., Ponomarenko N.A., Durova O., Ziganshin R., Gololobov G., Morse IIIrd H.C., Gabibov A.G., Tramontano A. Reactive selection of antibodies with nucleophilic residues poised for covalent catalysis. // 20th IUBMB International Congress of Biochemistry and Molecular Biology and 11th FAOBMB Congress. // June 18-23, 2006 Kyoto, Japan, Abstracts, p. 386.

6. Решетняк А.В., Пономаренко Н.А., Дурова О.М., Зиганшин Р.Х., Арментано М.-Ф., Трамонтано А.А. и Габибов А.Г. Эволюция ковалентного катализа в искусственных ферментах полученных из полусинтетической библиотеки генов Ig V. // XVIII зимней молодежной научной школе “Перспективные Направления Физико-химической Биологии и Биотехнологии” // Москва, 7-10 февраля, 2006, Сборник тезисов, с. 8.

7. Reshetnyak A.V. Screening of semisynthetic phage display library for catalytic antibodies with biotinylated phosphonate ester. // International Conference Fundamentals & Applications “Biocatalysis” // June 19-23, 2005, Abstracts p. 99.



 

Похожие работы:





 
2013 www.netess.ru - «Бесплатная библиотека авторефератов кандидатских и докторских диссертаций»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.