авторефераты диссертаций БЕСПЛАТНАЯ  БИБЛИОТЕКА

АВТОРЕФЕРАТЫ КАНДИДАТСКИХ, ДОКТОРСКИХ ДИССЕРТАЦИЙ

<< ГЛАВНАЯ
АГРОИНЖЕНЕРИЯ
АСТРОНОМИЯ
БЕЗОПАСНОСТЬ
БИОЛОГИЯ
ЗЕМЛЯ
ИНФОРМАТИКА
ИСКУССТВОВЕДЕНИЕ
ИСТОРИЯ
КУЛЬТУРОЛОГИЯ
МАШИНОСТРОЕНИЕ
МЕДИЦИНА
МЕТАЛЛУРГИЯ
МЕХАНИКА
ПЕДАГОГИКА
ПОЛИТИКА
ПРИБОРОСТРОЕНИЕ
ПРОДОВОЛЬСТВИЕ
ПСИХОЛОГИЯ
РАДИОТЕХНИКА
СЕЛЬСКОЕ ХОЗЯЙСТВО
СОЦИОЛОГИЯ
СТРОИТЕЛЬСТВО
ТЕХНИЧЕСКИЕ НАУКИ
ТРАНСПОРТ
ФАРМАЦЕВТИКА
ФИЗИКА
ФИЗИОЛОГИЯ
ФИЛОЛОГИЯ
ФИЛОСОФИЯ
ХИМИЯ
ЭКОНОМИКА
ЭЛЕКТРОТЕХНИКА
ЭНЕРГЕТИКА
ЮРИСПРУДЕНЦИЯ
ЯЗЫКОЗНАНИЕ
РАЗНОЕ
КОНТАКТЫ

Астрологический Прогноз на год: карьера, финансы, личная жизнь


Роль структуры поверхностных белков оболочечных вирусов в формировании вирионов

На правах рукописи

КОРДЮКОВА Лариса Валентиновна

РОЛЬ СТРУКТУРЫ ПОВЕРХНОСТНЫХ БЕЛКОВ ОБОЛОЧЕЧНЫХ ВИРУСОВ В

ФОРМИРОВАНИИ ВИРИОНОВ

03.01.03 – молекулярная биология

03.02.02 - вирусология

Автореферат

диссертации на соискание ученой степени

доктора биологических наук

Москва – 2013

Работа выполнена в отделе хроматографического анализа НИИ физико химической биологии имени А.Н. Белозерского Федерального государственного бюджетного образовательного учреждения высшего профессионального образования «Московский государственный университет имени М.В. Ломоносова»

Научный консультант:

Баратова Людмила Алексеевна доктор химических наук, профессор

Официальные оппоненты:

Бовин Николай Владимирович, доктор химических наук, профессор, Федеральное государственное бюджетное учреждение науки Институт биоорганической химии им. академиков М.М.

Шемякина и Ю.А. Овчинникова Российской академии наук, заведующий лабораторией углеводов Ленёва Ирина Анатольевна, доктор биологических наук, Федеральное государственное бюджетное учреждение «Научно-исследовательский институт вакцин и сывороток им. И.И.

Мечникова» Российской академии медицинских наук, заведующая лабораторией экспериментальной вирусологии Карягина-Жулина Анна Станиславовна, доктор биологических наук, профессор, Федеральное государственное бюджетное учреждение «НИИ эпидемиологии и микробиологии имени Н.Ф. Гамалеи»

Министерства здравоохранения и социального развития Российской Федерации лаборатория биологически активных наноструктур, главный научный сотрудник

Ведущая организация: Федеральное государственное бюджетное учреждение «Научно-исследовательский институт гриппа» Министерства здравоохранения и социального развития Российской Федерации.

Защита состоится декабря 2013 г. в _ на заседании Совета Д 501.001.76 по защите докторских и кандидатских диссертаций при Федеральном государственном бюджетном образовательном учреждении высшего профессионального образования «Московский государственный университет имени М.В. Ломоносова» по адресу: 119234, Москва, Ленинские горы, МГУ, Биологический факультет, ауд..

С диссертацией можно ознакомиться в Научной библиотеке МГУ имени М.В.

Ломоносова (Фундаментальная библиотека, Ломоносовский проспект, 27, отдел диссертаций) Автореферат разослан «» 2013 г.

Ученый секретарь диссертационного совета, кандидат биологических наук Крашенинников И.А.

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность проблемы. К группе оболочечных вирусов относятся многие опасные патогены, в том числе вирусы гриппа и респираторных инфекций, а также гепатитов, герпеса, геморрагических лихорадок, иммунодефицита человека и многие другие. Вакцино-профилактика в случае вируса гриппа А осложнена высокой изменчивостью поверхностных антигенов вириона. К препаратам, наиболее широко применяемым в настоящее время для лечения гриппа – ингибиторам ионного канала (белка М2) ремантадинового ряда и ингибиторам нейраминидазы – занамивиру и озелтамивиру достаточно быстро возникает резистентность. Таким образом, проблема профилактики и лечения вирусных инфекций не решена, несмотря на неустанный активный поиск и дизайн новых антивирусных препаратов (Vanderlinden & Naesens, 2013). В связи с этим не ослабевает актуальность фундаментального изучения структуры отдельных компонентов вириона и их взаимодействий, с целью целостного понимания сложной картины патогенеза оболочечных вирусов и в перспективе, для разработки новых антивирусных стратегий.

Оболочечные вирусы объединяет наличие липопротеиновой оболочки вокруг нуклеокапсида, которую вирион получает при «выпочковывании» с клеточной мембраны. На Рис. 1, А схематически представлен вирион вируса гриппа А, типичного представителя семейства Orthomixoviridae. Нуклеокапсид включает сегментов однонитевой РНК негативной полярности в комплексе с нуклеопротеином (NP) и белками полимеразного комплекса (PB1, PB2, PA).

А Б Рис. 1. А: Схема вириона вируса гриппа А. В липидный бислой встроены «шипы»

гликобелков НА, NA и белок М2 - ионный канал. Слой белка М1 ассоциирован с мембраной.

Б: Реконструкция фрагмента оболочки вириона по данным криоэлектронной томографии и рентгеноструктурного анализа (Harris et al., 2006).

В состав оболочки вириона входят два гликопротеина, образующие «шипы»:

мажорный гемагглютинин (НА) образует гомотримеры, а менее представленная по числу копий нейраминидаза (NA) - гомотетрамеры (Рис. 1, А, Б). Гемагглютинин отвечает за связывание вириона с клеткой-мишенью и слияние вирусной и эндосомальной мембран при кислом рН, что обеспечивает проникновение генома вируса в цитоплазму клетки. Кроме того, НА является основным вирусным антигеном. Нейраминидаза – фермент, который отщепляет сиаловую кислоту от клеточных рецепторов и способствует распространению вновь образованных вирионов от клетки к клетке. Минорный белок М2 (гомотетрамер) совмещает функции ионного канала и «отшнуровки» дочерних вирионов от плазматической мембраны клетки (Rossmann, 2010). К вирусной мембране изнутри прилегает слой молекул матриксного белка М1 - основного структурного белка вириона. Полагают, что белок М1 взаимодействует как с внутривирионными сегментами интегральных белков НА, NA, М2, так и рибонуклеокапсидом, обеспечивая сборку всех компонентов для формирования компетентных вирионов.



Данные рентгеноструктурного анализа (РСА) получены для водорастворимых структурно стабильных фрагментов поверхностных белков: «головы» NA (Рис. 1, Б) и эктодоменов НА (Рис. 1, Б & 2, А). Закристаллизованы также NM-фрагмент белка М1 и фрагмент М2, включающий ТМ-домен и амфифильную -спираль в СТ-домене.

А Б Рис. 2. Схема гомотримерного эктодомена (А) и мономера (Б) молекулы НА штамма A/Aichi/2/68 (H3N2). ТМ-трансмембранный домен, СТ-цитоплазматический домен.

Объяснения – в тексте.

Мономер НА состоит из двух полипептидных цепей (НА1 и НА2), связанных дисульфидной связью (Рис. 2, Б). «Тяжелая» цепь НА1 и большая часть «легкой»

цепи НА2 входят в состав гомотримера эктодомена (Рис. 2, А). Заякоривающий (С концевой) сегмент цепи НА2, который остается в мембране вириона после удаления эктодоменов бромелаином, включает (1) линкерную область, (2) трансмембранный (ТМ) домен (подчеркнуто) и (3) внутривирионный, или цитоплазматический (СТ) домен. В то время как эктодомен гемагглютинина при кислом значении рН радикально перестраивается, гомотримерный комплекс ТМ-доменов сохраняет свою структурную целостность, создавая необходимое напряжение для формирования и расширения поры слияния. Пространственная организация гомотримера ТМ доменов не определена. Отсутствует информация и об архитектуре «ножки»

«шипа», включающей гомотример линкерных последовательностей, которые также несут функциональную нагрузку при слиянии мембран.

На сегодняшний день описаны 17 антигенных подтипов НА вируса гриппа А, которые согласно 3-D-структуре эктодоменов образуют две эволюционные группы:

Группу-1 (Н1-Группа) и Группу-2 (Н3-Группа), включающие 3 клада (Н1, Н2, Н5, Н6, Н17);

(Н8, Н9, Н12);

(Н11, Н13, Н16) и 2 клада (Н3, Н4, Н14);

(Н7, Н10, Н15), соответственно (Nobusawa et al., 1991, Pica and Palese, 2013). Стоит отметить, что большинство используемых в настоящее время вакцин по-прежнему остаются Групп- и подтип-специфичными. У вируса В антигенные подтипы не выделяют.

Структурные различия гомотримерных комплексов ТМ-доменов и линкерных последовательностей в контексте разных эволюционных Групп НА систематически не изучались. Можно предположить, что изучение этих характеристик, в частности, поможет лучше понять экспериментально наблюдаемые различия в параметрах слияния мембран при участии НА подтипов Н1, Н2 и Н3 (Korte et al., 1997;

1999).

Особое внимание в данной работе уделено крайне консервативной модификации определенных остатков цистеина в С-концевой области НА остатками высших жирных кислот (Рис. 2, Б). Эта пост-трансляционная модификация – пальмитилирование, или S-ацилирование - была обнаружена у вирусных белков более 30 лет назад (Schmidt & Schlessinger, 1979). Достаточно рано было показано, что не только пальмитиновая (гексадекановая, С 16:0), но и жирные кислоты других типов могут ковалентно присоединяться к белку (Schmidt, 1984). Однако настоящий интерес к этой липидной модификации возник недавно, когда были найдены ферменты – DHHC-ацилтрансферазы, выполняющие функцию переноса остатка жирной кислоты на клеточные белки-субстраты (Linder & Deschenes, 2007). В геноме человека закодировано 23 таких фермента, но ни для одного из них пока не показана функция S-ацилирования какого-либо белка вируса.

Остатки высших жирных кислот, по-видимому, присоединяются к гемагглютинину вируса гриппа в раннем Гольджи, после тримеризации белка (Veit, 1993). Все 17 антигенных подтипов НА вируса гриппа А содержат как минимум три обязательных сайта ацилирования: один расположен у большинства подтипов на С конце TM-домена и два – в СТ-домене (Рис. 2, Б). Специфического паттерна «узнавания» для пальмитилирования (как, например, в случае гликозилирования), не найдено. Однако остатки цистеина, которые локализованы у НА ряда подтипов в середине ТМ-домена (Рис. 2, Б), никогда не связывают остатки жирных кислот.

Данные о структурных предпочтениях остатков жирных кислот разной химической природы и единое представление относительно функции S ацилирования в вирионе отсутствуют. Установлено, что пальмитилирование НА не требуется ни для прикрепления белка к мембране, ни для его внутриклеточного транспорта по эндоцитозному пути на поверхность вириона (Veit et al., 1991). Однако модификация жирными кислотами существенна для репликации вируса, поскольку рекомбинантные частицы, содержащие мутантные молекулы НА с заменой более одного сайта ацилирования, либо (в зависимости от штамма) очень плохо продуцируются, либо не продуцируются вовсе при получении их методом обратной генетики (Chen et al., 2005;

Wagner et al., 2005).

До сих пор нет четкого понимания, на какой из стадий жизненного цикла вируса эта модификация необходима: влияют ли ковалентно связанные остатки жирных кислот на процесс слияния мембран и/или сборки дочерних вирионов и вовлечены ли они во взаимодействия с другими белками вириона. Ситуация осложняется разноречивыми экспериментальными данными, полученными для разных антигенных подтипов НА. Тип остатка жирной кислоты представляет особенный интерес, поскольку углеводородные цепи, различающиеся по длине только на два углеродных атома, демонстрируют значительную разницу в гидрофобности. Этот параметр может влиять на силу взаимодействия белка с мембраной и на силу белок-белковых взаимодействий.

Цель и задачи исследования. Целью данной работы является исследование структуры С-концевой области (заякоривающего сегмента) гемагглютинина вируса гриппа и поверхностных белков других оболочечных вирусов и анализ ее роли в формировании вирионов.

Для достижения вышеописанной цели были поставлены следующие задачи:

Создать подход для исследования структурных свойств надмолекулярного 1.

комплекса линкерных последовательностей - «ножки» «шипа» гемагглютинина вируса гриппа разных антигенных подтипов/типов;

Разработать методологию изучения гомотримерной ассоциации 2.

трансмембранных доменов гемагглютинина вируса гриппа с применением экспериментальных подходов и компьютерного моделирования;

Отработать протокол анализа пост-трансляционной модификации остатками 3.

высших жирных кислот (S-ацилирования) поверхностных белков, выполняющих функцию слияния мембран. Использовать в качестве объекта гемагглютинин вируса гриппа и ряд белков других семейств оболочечных вирусов. Сформулировать концепцию о полноте и гетерогенности S-ацилирования белка в составе вириона;

Создать экспериментальные модели для исследования структурной и 4.

биологической значимости S-ацилирования вирусных белков, включая (1) серию лабораторных реассортантов вируса гриппа А с поверхностными и внутренними белками, полученными от разных родительских штаммов/хозяев;

(2) синтетический пептид, стехиометрически алкилированный гексадекановыми алифатическими цепями (имитирующими пальмитилирование), встроенный в липидные везикулы;

Изучить с применением современных методик молекулярного моделирования 5.

принципиальную возможность участия остатков жирных кислот в образовании гомотримерного комплекса трансмембранных доменов гемагглютинина при формировании вирионов.

Решение поставленных задач должно было дать новую структурную информацию о сегментах белков, входящих в состав оболочки вириона, изучение пространственной организации которых методом РСА затруднено.

Научная новизна и практическая значимость работы. Современное представление о патогенезе вируса гриппа и других оболочечных вирусов, среди которых описано много опасных патогенов человека и животных, предполагает понимание молекулярных перестроек белков вириона при проникновении вируса в клетку и морфогенезе дочерних вирионов. Однако экспериментальных исследований для понимания роли каждого компонента вириона в жизненном цикле вируса и его взаимодействия с системой везикулярного транспорта в клетке недостаточно. Это определяет актуальность исследования особенностей структуры поверхностных белков оболочечных вирусов, в частности, гидрофобных сегментов белков, встроенных в липидную мембрану. Кроме того, в связи с высокой изменчивостью вируса гриппа, риском новых пандемий и крайне скромным арсеналом средств борьбы с ним в эпидемических условиях, существует острая необходимость планирования и разработки новых антивирусных стратегий. В связи с этим выяснение молекулярных механизмов, лежащих в основе взаимодействия хозяина и патогена, представляется актуальным.

Протеолиз целых вирионов был впервые предложен в качестве подхода для изучения структурной организации области «ножки» шипа, включающей гомотример линкерных участков. Обнаружено, что локализация сайтов гидролиза ферментами разных классов определяется, главным образом, стерической доступностью зоны расщепления для молекулы фермента, а не собственно специфичностью фермента.

В перспективе не исключена возможность прицельного разрушения поверхностных гликопротеинов специально подобранными ферментами с целью ограничить распространение вирусной инфекции.

Гидролиз протеазами поверхностных белков, выделенных из интактных вирионов неионным детергентом, непосредственно в мицелле, был предложен как способ экспериментального анализа упаковки трансмембранных доменов белков в составе природных олигомеров. Обнаруженные различия в гомотримерной упаковке трансмембранных доменов у гемагглютининов разных эволюционных групп вируса гриппа А, подтвержденные данными компьютерного моделирования, проясняют, почему невозможно формирование «смешанных» тримеров НА подтипов Н1 и Н3, Н1 и Н7 (Sklyanskaya e al., 1988).

S-ацилирование вплоть до недавнего времени детектировали на основании метаболического мечения вирусов [3H]-пальмитатом и выяснения, в какой белок включается метка. Последующий хроматографический анализ пула связанных жирных кислот (Veit, 1991) не давал точной информации ни о полноте S ацилирования белка, ни о типах реально присоединенных к белку остатков жирных кислот, ни об их распределении по потенциальным сайтам. Показано, что в клетке могут происходить метаболические трансформации меченого пальмитата в другой тип жирной кислоты еще до присоединения к белку (Schmidt, 1984). Мы предложили экстрагировать ацилированные пептиды в органическую фазу (сходно с методом экстракции липидов) из обработанных протеазами вирионов. Успешное применение масс-спектрометрического (МС) анализа для детекции гидрофобных пептидов привело к созданию уникального протокола, который до сих пор не имеет аналогов в мире.

Впервые показано, что в составе вирионов молекулы НА ацилированы стехиометрически: все потенциальные сайты модифицированы остатками жирных кислот. Далее, обнаружено дифференциальное остатками S-ацилирование пальмитата (С16:0), либо стеарата (С 18:0) в зависимости от локализации сайта ацилирования относительно границы липидного бислоя: только остаток цистеина, расположенный на границе ТМ- и СТ-доменов, может связать стеарат, в то время как остатки цистеина в СТ-домене ацилированы исключительно пальмитатами.

Выдвинутая гипотеза о локализации стеарата на остатке цистеина, расположенном на границе ТМ- и СТ-доменов, оказалась верной в случае гемагглютининов всех типов вируса гриппа, а также всех исследованных представителей «сливающих» белков других семейств оболочечных вирусов.

Принципиально разный характер ацилирования, который был обнаружен у НА вирусов гриппа А, В и гомологичного белка гемагглютинин-эстеразы (HEF) вируса гриппа С может быть использован для типирования новых штаммов вируса гриппа.

Впервые предпринята попытка оценить биологическую роль S стеарилирования в экспериментальной модели, использующей серию лабораторных реассортантных клонов, включающих NA и/или НА одного штамма, а внутренние белки - другого. Показано, что ни нейраминидаза, ни белки М1/М2 не влияют на гетерогенность S-ацилирования гомотримера НА в процессе созревания вирионов.

Впервые исследованы свойства пептида из 47 аминокислотных остатков, соответствующего С-концевой области штамма A/FPV/Rostock/34 (H7N1), синтезированного в бесклеточной системе (Khabibullina et al., 2010, Mineev et al., 2011) и модифицированного гексадекановыми (С 16:0) алифатическими цепями с целью имитировать пальмитилирование.

Значительная часть представленных в данной работе данных относится к вирусу гриппа, однако это не умаляет общности применения разработанных подходов для исследования белков других оболочечных вирусов, а также эукариотической клетки.

Апробация работы. Диссертация была апробирована на заседании ученого совета НИИ физико-химической биологии имени А.Н.Белозерского МГУ. Результаты, изложенные в диссертации, неоднократно представлялись на российских и международных научных конференциях. Материалы работы докладывались на Европейских Вирусологических конгрессах (EVC-2007, ECV-2010), конференции Биохимического Общества Великобритании «Регуляция движения и функции белков при помощи пальмитилирования» (2012), конференции Федерации Американских обществ экспериментальной биологии (FASEB) “Модификация белков липидами, ее сигнальная функция и мембранные домены” (2013), Европейских и Американских пептидных симпозиумах с 2004 по 2007 гг., Китайском пептидном симпозиуме (2006), Российских симпозиумах «Белки и пептиды» (2007, 2011), Московских конференциях по вычислительной молекулярной биологии MCCMB (2007, 2009, 2011), IV съезде Российского общества биохимиков и молекулярных биологов (Новосибирск, 2008), а также на конференциях Немецкого общества вирусологов (2008, 2010, 2012), Российско-Германских научных семинарах (Берлин, 2007, 2008, 2009) и на школе конференции для молодых ученых «Методы изучения вируса гриппа», проведенной в рамках Германо-Российского года науки, образования и инноваций (2011) на базе Института иммунологии и молекулярной биологии факультета Ветеринарной Медицины Свободного Университета г. Берлин (Германия).

Публикации. По результатам исследований опубликовано 17 работ в рецензируемых научных изданиях, рекомендованных ВАК РФ, в том числе обзорные статьи в журналах Биохимия и Biochemical Society Transactions, а также экспериментальные статьи в ведущих международных и Российских рецензируемых журналах, включая Journal of Virology, Virology, Biochimica et Biophisica Acta, Virus Research, Archives of Virology, Protein and Peptide Letters, Молекулярная биология, Вопросы вирусологии. Также опубликованы материалы работы Российских и международных конференций – 17.

Структура и объем работы. Диссертационная работа изложена на страницах машинописного текста и содержит следующие разделы: введение, обзор литературы, материалы и методы, результаты и обсуждение, выводы, список литературы. Материал иллюстрирован рисунками и таблицами.

_ _ Библиографический указатель включает цитированных работ.

РЕЗУЛЬТАТЫ ИССЛЕДОВАНИЙ И ОБСУЖДЕНИЕ I. Протеолиз как инструмент изучения структурной организации линкерных последовательностей и трансмембранных доменов.

1. Протеолиз гемагглютинина вируса гриппа в интактных вирионах.

Общая схема эксперимента получения субвирусных частиц, полностью лишенных «шипов» поверхностных белков, для последующей экстракции из них заякоривающих сегментов, представлена на Рис. 3. На первом этапе эктодомены гликобелков удаляли протеолитическим ферментом. Полученные субвирусные частицы отделяли от фермента и фракции эктодоменов высокоскоростным центрифугированием и подвергали экстракции смесью хлороформ/метанол по Фолчу. МС-анализ всех трех образующихся фаз (водно-метанольной, органической и интерфазы) показал, что оставшиеся в оболочке вириона заякоривающие сегменты гликобелков (НА и NA) экстрагируются вместе с липидными молекулами только в органическую (хлороформную) фазу. Это позволило нам утверждать, что исследуемые пептиды представляют собой полный пул вариантов, присутствующих в вирионах in situ. Данные N-концевого сиквенса подтвердили присутствие в органической фазе мажорных пептидов, детектированных с помощью МС.

Рис. 3. Схема эксперимента по выделению и МС-анализу заякоривающих сегментов гликобелков вирусной оболочки.

Для удаления поверхностных гликобелков мы воспользовались модифицированной методикой обработки вирионов цистеиновой протеиназой бромелаином (Brand & Skehel, 1972), которая у ряда вирусов показала отличные результаты (Рис. 4). Оказалось, что гемагглютинин вируса гриппа эффективно удаляется с поверхности вирионов даже в отсутствие восстанавливающих реагентов (при увеличении времени реакции), что дало нам возможность в дальнейшем использовать полученные субвирусные частицы для изучения S-ацилирования заякоренных в мембрану С-концевых сегментов НА (подробно рассмотрено в разделе II).

Рис. 4. Анализ препаратов субвирусных частиц вируса гриппа Х-31 (H3N2), полученных обработкой вирионов бромелаином без восстановления.

(А, Б): слой «шипов» гликобелков хорошо различим при просвечивающей электронной микроскопии негативно-контрастированных интактных вирионов (А), но отсутствует в случае субвирусных частиц (Б).

(В): полоса НА, наблюдаемая при SDS-ПААГ интактных вирионов (1), отсутствует в препарате субвирусных частиц (2, стрелка).

Вирусы других семейств, например, тогавирусы, гидролизовались бромелаином плохо. Мы протестировали также цистеиновую протеиназу папаин, сериновые протеиназы субтилизин Карлсберг, трипсин и -химотрипсин, ферментный препарат проназу E (из Streptomyces griseus), металлопротеиназу термолизин и обнаружили, что чувствительность ферментов зависит от выбранного вида/штамма вируса. Это навело нас на мысль использовать протеолиз как инструмент для исследования особенностей архитектуры поверхностных белков.





Наиболее детально чувствительность различных штаммов вируса гриппа к гидролизу была исследована на примере выбранных «модельных» ферментов:

бромелаина (в отсутствие восстанавливающих реагентов) и субтилизина Карлсберг (Табл. 1). Cубтилизин в целом был менее эффективным, чем бромелаин (даже при соотношении вирусный белок/ субтилизин = 1/2 гидролиз НА проходил частично, в то время как соотношение вирусный белок/ бромелаин = 4/1 обычно было достаточно для полного удаления «шипов» НА). Особенно ярко это проявлялось в случае НА, принадлежащих к эволюционной Группе-2/Клайду Н3 (см. Табл. 1). С другой стороны, многие штаммы из Группы-1 вируса типа А и вирус типа В превосходно гидролизовались субтилизином, а в ряде случаев этот фермент оказывался даже более эффективным, чем бромелаин (подтипы Н13, Н16). Отметим, что все ферменты были активны по отношению к специфическим хромогенным субстратам.

Поэтому можно было предположить, что обнаруженные различия связаны либо (1) с особенностями субстратной специфичности ферментов и/или (2) иными факторами, например, особенностями архитектуры «шипа» НА.

Сайты гидролиза НА ферментами были определены с помощью МАЛДИ времяпролетной масс-спектрометрии (далее – МС) (Рис. 5). Экспериментально определяли N-конец экстрагированного пептида, который по принятой номенклатуре (Berger & Schechter, 1970) обозначается как сайт Р1' (Рис. 5). Р1-сайт определяли по известной из базы данных последовательности НА исследуемого штамма. Как следует из Рис. 5, чувствительность к гидролизу обоими ферментами серьезно различается у штаммов подтипов Н6 и Н12. Однако сайты Р1', Р1, и Р2 (в первом приближении наиболее существенные для характеристики специфичности ферментов), представлены одинаковыми аминокислотными остатками (а.о.). Таким образом, присутствие/отсутствие специфических сайтов гидролиза в аминокислотных последовательностях разных штаммов НА не может быть причиной различий чувствительности НА к гидролизу.

Таблица 1. Чувствительность HA на поверхности вирионов к протеолизу бромелаином и субтилизином. Вирус гриппа A2 Бромелаин3 Субтилизин Группа- Клад H1a Puerto Rico/8/34(H1N1) ++++ +++ USSR/90/77(H1N1) +++ ++ Duck/Alberta/35/76(H1N1) ++++ +++ Krasnodar/101/59(H2N2) ++++ ++++ Leningrad/134/17/57 ca(H2N2) ++++ +++ Pintail/Primorie/695/76(H2N3) +++ +/ +++++ Duck/Primorie/2621/01(H5N2) ++++ NIBRG-14(HA VN/1194/04;

H5N1) ++++ ++++ Shearwater/Australia/72(H6N5) ++++ ++++ Клад H1b Duck/England/1/56(H11N6) ++++ +++ Gull/Astrakhan/1846/98(H13N6) ++ ++++ +++++ BH Gull/Sweden/2/99(H16N3) ++++ Клад H ++ Swine/Hong Kong/9/98(H9N2) + Teal/Primorie/3631/02(H9N2) ++ ND Teal/Primorie/3628/02(H9N2) ND ++++ Duck/Alberta/60/76(H12N5) +/- +/ Группа- Клад H ++ England/42/72(H3N2) +/ Equine/Miami/1/63(H3N8) +++ +/ Duck/Czechoslovakia/56(H4N6) ++++ + Mallard/Astrakhan/244/82(H14N6) ++++ + Клад H FPV/Rostock/34(H7N1) ++++ ++ Chicken/Germany/N/49(H10N7) ++++ +/ Вирус гриппа B +++++8 +++++ Hong Kong/8/ Сравнивали интенсивности окрашенных Кумасси полос НА в препаратах интактных вирионов и субвирусных частиц, получаемых при соотношении вирусный белок/фермент: 4/ (бромелаин);

1/2 (субтилизин). Результаты представлены в виде “+/-“ (удалено 0-5% HA);

“+” (10-35%);

“++” (40-60%);

“+++” (65-90%);

“++++” (95-100%) или “+++++” (95-100% HA удаляется при меньшем соотношении фермент/вирус). ND – не определяли.

Сокращения: VN=Viet Nam;

BH Gull=Black-headed gull;

FPV=Fowl Plaque Virus.

Реакцию проводили в отсутствие восстанавливающего реагента.

вирус/субтилизин = 2/1;

5вирус/субтилизин = 8/1;

6вирус/бромелаин = 1/1;

7вирус/бромелаин = 2/1;

8вирус/бромелаин = 10/1.

Рис. 5. Идентификация сайтов гидролиза НА на поверхности вирионов. А, Г:

Представлены электрофореграммы вирионов до (вир) и после обработки бромелаином (бр) или субтилизином (субт). Б, Д: MС-анализ органической фазы после экстракции субвирусных частиц. В, Е: аминокислотная последовательность с указанием сайтов расщепления ферментами (длина стрелок находится в прямой пропорциональности с «представленностью» пептида в смеси. Последняя оценивалась по высоте пика на масс спектрах). Для мажорных пептидов обозначены сайты Р1'Р2'Р3', определяемые экспериментально, и сайты Р1Р2Р3Р4, «привязанные» к последовательности из базы данных (подтвержденной МС/МС). Номенклатура по (Berger & Schechter, 1970).

Оба фермента обладают широкой субстратной специфичностью (http://merops.sanger.ac.uk), которая, однако, различается. В то время как бромелаин предпочитает положительно заряженные или полярные а.о. в Р1-положении (R,Q,MT,K,L»S,F,A,E) (Choe et al., 2006) и гидрофобный а.о. (Leu, Phe) в Р (Filippova et al., 1984), для субтилизина оптимально присутствие «большого»

гидрофобного а.о. в Р1 и Р4 (F,Y,L) и в гораздо меньшей степени для Р1-сайта подходят M,Q,K (Meldal et al., 1994;

Siezen & Leunissen, 1997;

Ruan et al., 2008).

Мы определили сайты гидролиза НА на поверхности вирионов разных подтипов и типов вируса, а также проанализировали, насколько известные субстратные специфичности ферментов согласуются с их «предпочтениями» в нашей системе «фермент – «шип» НА» (Табл. 2;

Рис. 6, А).

Таблица 2. Сравнение идентифицированных сайтов гидролиза HA на поверхности вирионов с субстратной специфичностью бромелаина и субтилизина*.

Подтипы вируса Бромелаин Субтилизин ** ** гриппа А Предпочтения Предпочтения P1-сайт P1-сайт Группа- H1 K +++ L ++++ L +++ H2 L ++++ K +++ L ++++ H5 K +++ V + L ++++ H6 K +++ V + K +++ H9 L ++++ E + H12 K +++ L ++++ H11 K +++ L ++++ K + H13 L +++ L ++++ H16 L +++ L ++++ Группа- H3 K +++ K + Q ++ H4 K +++ K + H14 T +++ L ++++ H7 K +++ L ++++ H10 K +++ L ++++ Тип В - N +/- L ++++ * Оценивается от “+/- “ до “++++”.

** Главные P1-предпочтения указаны первыми.

Рис. 6. Множественное выравнивание С-концевых последовательностей HA и Р1 сайты гидролиза на поверхности вирионов (А), либо в составе мицелл неионного детергента (Б) бромелаином (зеленый), субтилизином (оранжевый, желтый), либо обоими ферментами (синий, голубой) по данным МС. Основные сайты обозначены шрифтом более яркого оттенка (темно-зеленый, оранжевый, синий) и выделены серой заливкой. Минорные сайты обозначены более светлым оттенком (салатовый, желтый, голубой). Ацилированные остатки цистеина показаны красным шрифтом. Остатки, участвующие в предполагаемых взаимодействиях между мономерами в моделях НА подтипов H6 и H14 (см. Рис. 12), помечены звездочками на панели Б. Среди них - остатки Phe, образующие стэкирующие пары на внутреннем интерфейсе гомотримера ТМ-доменов, помеченные квадратиками.

Оказалось, что в случае гидролиза гемагглютинина на поверхности вирионов:

(1) все Р1-сайты локализованы в линкерной области между экто- и ТМ-доменом (Рис. 6, А);

(2) в целом ферменты действуют согласно своей субстратной специфичности, но есть и исключения (Таблица 2). Помимо «понятных» с точки зрения субстратной специфичности а.о. (лизин в Р1 для бромелаина;

лейцин в Р для субтилизина), иные остатки также присутствовали в Р1, несмотря на то, что «подходящие» а.о. находились рядом;

(3) обнаруженные различия были строго подтип-специфичными. Так, в случае штаммов подтипов Н3 и Н13, субтилизин предпочитал расщеплять пептидную связь после остатка лизина, а не после лейцина, локализованного тут же. Мы предположили, что обнаруженные различия связаны с различиями в архитектуре «ножки» «шипа» НА, куда входит гомотример линкерных областей, и/или прилегающих областей эктодомена, а протеолиз позволяет нам «визуализовать» эти различия. Чтобы оценить реальность нашего предположения, мы попробовали расположить рядом «ножку» «шипа» НА и молекулы использованных ферментов (Рис. 7).

Рис. 7. Суперпозиция «шипа» НА и молекул ферментов. А: 3-D модели бромелаина и субтилизина представлены в том же масштабе, что и гомотример эктодомена НА (Н3 подтип). Б, В: Показаны зоны связывания бромелаина (S3-S1? нанесенные на модель по, аналогии с папаином, Kim et al., 1992;

Patel et al., 1992) и субтилизина (S4-S2? Siezen &, Leunissen, 1997) и электростатические свойства поверхности: положительно заряженные области окрашены синим, отрицательно заряженные – красным, нейтральные - белым (по данным программы APBS, Baker et al., 2001). Pal - пальмитат, Str – стеарат.

Сопоставление данных РСА и криоэлектронной томографии (Wilson et al., 1981;

Bottcher et al., 1999;

Harris et al., 2006) позволяет рассчитать, что высота «ножки» «шипа», включающей гомотример линкерных последовательностей, не превышает 18-20 A над мембраной вириона (Рис. 7). Размеры же моделей ферментов, которые мы построили на основании известных 3D-координат (субтилизин), либо с использованием гомологичного моделирования (бромелаин), оказались в 2 раза больше (~45 A3). Каким же образом активный центр фермента достигает тех участков НА, где происходит гидролиз пептидной связи?

В последние годы все большую популярность получает теория наличия во многих белках, в том числе вирусных, т.н. «внутренне неупорядоченных областей», структура которых может меняться в зависимости от функционального состояния белка (Xue et al., 2010). Мы предположили, что именно структурная пластичность проксимальной зоны эктодомена обеспечивает стерическую доступность фермента к зоне гидролиза. Расчеты с использованием ряда алгоритмов подтвердили, что а.о.

161-175 являются «неупорядоченными», причем вероятность этого выше у всех проанализированных подтипов НА, принадлежащих к Группе-1 (H1, H2, H5, H6, H13, H16, H9, H12), по сравнению с подтипами из Группы-2 (H3, H4, H14, H7) (Рис. 8).

Принимая, что именно структурная неупорядоченность проксимальной области эктодомена обеспечивает молекулам ферментов доступ к сайтам гидролиза в «ножке» «шипа», мы полагаем, что НА Группы-1 должны легче гидролизоваться ферментами, чем НА Группы-2, что и было показано нами ранее экспериментально.

Различия в чувствительности большинства штаммов (особенно из Группы-2) к бромелаину по сравнению с субтилизином, вероятно, можно частично объяснить наличием у бромелаина узкой/глубокой зоны связывания с субстратом (S3-S1? в то ) время как зона связывания субтилизина (S4-S2? имеет более широкую/плоскую ) конфигурацию (см. Рис. 7). Кроме того, по данным расчета электростатического потенциала поверхность бромелаина, вероятно, более гидрофильна, чем в случае субтилизина (Рис. 7, Б, В) (Эти данные, однако, надо интерпретировать с осторожностью, поскольку расчеты проводились без учета водной «шубы» вокруг молекул.) Таким образом, обнаруженные нами подтип-специфичные особенности сайтов гидролиза мы объясняем особенностями архитектуры субстрата – гомотримерного комплекса линкерных последовательностей «шипа» НА и прилегающей к нему проксимальной зоны эктодомена.

Рис. 8. Оценка «внутренней неупорядоченности» НА2. Профили неупорядоченности рассчитывали по алгоритму DISOPRED2 (Ward et al., 2004;

http://bioinf.cs.ucl.ac.uk/disopred) для целой цепи HA2 (A), либо ее C-концевой области (Б). Пороговый уровень (5%), выше которого структура считается «неупорядоченной», обозначен горизонтальной пунктирной линией. А: Три зоны неупорядоченности в НА2-цепи согласуются с данными литературы (Goh et al., 2009). Б: Неупорядоченность проксимальной области эктодомена НА (а.о. 161 175) подтипов Группы-1 ярче выражена по сравнению с Группой-2. Обозначены: ECTO проксимальная зона эктодомена, linker – линкерная область, ТМ - ТМ-домен, СТ цитоплазматический (внутривирионный) домен.

Наше представление о большей «жесткости» прилегающей к мембране вириона проксимальной области эктодомена в случае НА Группы-2 по сравнению с НА Группы-1 согласуется с данными 3-D-анализа НА разных подтипов из базы данных PDB (Рис. 9).

Рис. 9. Фрагменты 3D-структур эктодоменов НА разных подтипов вируса гриппа А (Н3, Н7, Н1, Н5, Н5-рекомбинантный) и вируса гриппа В (PBD ID: 2VIU;

1TI8;

1RVX;

1JSM;

2FK0;

2RFT, соответственно), визуализованные при помощи программы PyMol.

Стрелками указан остаток 158 НА2 (начало ближайшей к мембране спирали Н). Обозначены также остатки 175 (последний из 3d-определенных остатков) и 185, расположенный в начале ТМ-домена (нумерация для подтипа Н3). Ближайшая к мембране спираль Н сохранена в кристалле рекомбинантного (H5-rec) НА, но отсутствовует у всех НА (кроме подтипа Н3), полученных «срезанием» с поверхности вирионов бромелаином. Слева скобкой указана лабильная при протеолизе область.

На представленных структурах видно, что если перед кристаллизацией гемагглютинин удаляли с вирионов бромелаином, ближайшая к липидной мембране альфа-спираль Н (а.о. 158-175 (Wilson et al., 1981), начало ее указано стрелкой) сохранена полностью или частично у гемагглютинина подтипа Н3 (Клад Н3) и Н (Клад 7) из Группы-2, соответственно, но отсутствует (мы предполагаем, что разрушается) у подтипов Н1 и Н5 из Группы-1. В случае рекомбинантного Н спираль сохранена. У гемагглютинина вируса типа В в этой области обнаружены бета-повороты.

Структурные особенности и свойства относительной лабильности «ножки»

«шипа» НА у разных штаммов, скорее всего, несут и функциональную нагрузку, т.е.

могут влиять на способность вируса эффективно связываться с поверхностью плазматической мембраны клетки-хозяина и/или участвовать в перестройках молекулы НА, происходящих при функционально активном кислом рН в эндосоме клетки.

2. Протеолиз гемагглютинина вируса гриппа в составе мицелл.

Как было сказано во введении, по данным РСА эктодомен НА организован в виде тримера (см. Рис. 2, А). Эктодомен НА подвергается значительным перестройкам при кислом рН, приводящим к слиянию мембран: НА1-цепи расходятся как лепестки цветка;

пептид слияния встраивается в мембрану мишень;

тример центральных спиралей цепи НА2 образует шпильку, подтягивая мембрану мишень к вирусной мембране. Комплекс ТМ-доменов при этом не распадается, а напротив, становится еще более плотным (Chang et al., 2008), создавая необходимое напряжение для образования поры слияния. Но как организован этот комплекс, совершенно неизвестно.

Мы предложили подход, который позволил нам получить уникальную информацию об ассоциации ТМ доменов НА. Подход включает мягкую экстракцию гомотримеров НА из вирионов неионным детергентом (Igepal, NP-40) и их ограниченный протеолиз в составе мицелл различными ферментами с последующей экстракцией в органическую фазу и МС-анализом (Рис. 10).

Рис. 10. Схема экстракции из вирионов и протеолиза НА в составе мицелл.

Были исследованы различные штаммы, принадлежащие к 14-ти из 16-ти известных антигенных подтипов НА вируса гриппа А, а также штаммы вируса гриппа В. Результаты гидролиза (Р1-сайты расщепления) отмечены на выравнивании последовательностей, приведенном на Рис. 6, Б. Оказалось, что все разновидности НА вируса гриппа А гидролизуются бромелаином в линкерной области "над" ТМ доменом, при этом ТМ-домен и цитоплазматический домен остаются интактными, что говорит о сохранности гомотримерной структуры НА.

Гидролиз НА субтилизином Карлсберг в случае подтипов из Группы-2 (H3, H4, H7, H10, H14) также затрагивал только линкерную область. Напротив, все исследованные представители НА из Группы-1 (H1, H2, H5, H6, H9, H11, H12, H13 и H16) расщеплялись субтилизином в ТМ-домене. Из них штаммы подтипов Н1, Н2, Н имеют минорные сайты гидролиза ближе к С-концу ТМ-домена. Обнаруженные нами различия в характере гидролиза нельзя объяснить ферментной специфичностью (подходящие а.о. для гидролиза субтилизином присутствуют в области ТМ-доменов обеих Групп НА). Поэтому мы заключаем, что в случае НА из Группы-2 сайты гидролиза стерически недоступны. Очевидно, ТМ-домены НА Группы- ассоциированы плотнее по сравнению с НА Группы-1. Вирусы гриппа В расщеплялись в ТМ-домене не только субтилизином, но и бромелаином. Вероятно, гомотример ТМ-доменов НА вируса гриппа В организован наименее плотно.

Интересно, что в случае НА подтипов Группы-1 первый «разрез» происходит в линкерной области (как и в случае НА Группы-2), приводя к удалению эктодомена.

По-видимому, это ослабляет ассоциацию ТМ-доменов в N-концевой части тримера, облегчая гидролиз. «Кинетические» эксперименты выявили в случае НА штамма A/Krasnodar/101/59 (H2N2) наиболее «глубоко» расположенные в ТМ-домене сайты гидролиза после инкубации с субтилизином в течение 30 минут (Рис. 11).

Рис. 11. Электрофоретический и МС-анализ протеолиза в мицеллах НА штамма A/Krasnodar/101/59 (H2N2) (Группа-1) бромелаином и субтилизином. (A): SDS-ПААГ препаратов HA до (-) и после обработки бромелаином (+ бр) в течение 30 мин, либо субтилизином (+ субт) в течение разных промежутков времени (5, 15, 30 мин). (Б): МС анализ. Указаны номера первого и последнего а.о. идентифицированных пептидов в смеси после экстракции в органическую фазу. (В) Аминокислотная последовательность С концевой последовательности НА с указанием сайтов гидролиза бромелаином и субтилизином (стрелки). TM-домен подчеркнут.

Более длинные пептиды с N-концом, локализованном в линкерной области, детектируются после 5-минутной обработки тримеров НА субтилизином. Позднее они «исчезают» из смеси, а им на смену приходят более короткие пептиды с N концом, расположенным в верхней трети-половине ТМ-домена. Детектированные сайты гидролиза субтилизином располагались после каждого второго, третьего или пятого а.о. (Рис. 11, В). Поскольку на виток -спирали приходится примерно 3.6 а.о., мы полагаем, что фермент гидролизует как «внешнюю» (обращенную к липидам/детергенту), так и «внутреннюю» (расположенную на интерфейсе гомотримера) поверхность -спирали. Это еще раз показывает отсутствие неспецифического гидролиза. С-концевая половина ТМ-домена в нашем протоколе никогда не гидролизовалась, и мы полагаем, что ТМ-домены сохраняют свою гомотримерную ассоциацию в С-концевой половине комплекса. Возникает вопрос:

какие факторы участвуют в стабилизации ТМ-доменов?

Мы далее применили оригинальные методики компьютерного моделирования in silico (Polyansky et al., 2011), для того чтобы тестировать нашу гипотезу о более плотной упаковке ТМ-доменов НА Группы-2 по сравнению с НА Группы-1 вируса гриппа А.

На Рис. 12 представлены модели НА двух подтипов – представителей разных Групп вируса гриппа А: Н6, штамм A/shearwater/Australia/1/1972 (H6N5) (Группа-1) и Н14, штамм A/mallard/Astrakhan/263/1982 (H14N5) (Группа-2), построенные из расчетов молекулярной динамики (MD) в мембрано-подобных средах. Модель гомотримера ТМ-доменов НА подтипа Н14 (Группа-2) оказалась более компактной, чем НА подтипа Н6 (Группа-1). Эффективность «упаковки» оценивалась в терминах «компактности» C=1-SASAtrim/3 x SASAmono, где SASAtrim and SASAmono – площади доступной раствору поверхности в тримере и мономере, соответственно. Мы предполагаем, что более плотная ассоциация мономеров может быть обусловлена стэкирующими взаимодействиями между ароматическими аминокислотными остатками (фенилаланинами), локализованными на внутреннем интерфейсе тримера Н14 и отсутствующими в аминокислотной последовательности НА подтипов Группы-1. Остатки серина, аланина, глицина, лейцина, изолейцина образуют более слабые контакты на внутреннем интерфейсе гомотримера Н6 (отмечены на Рис. 6, Б).

Рис. 12. Модели гомотримеров ТМ-доменов НА, принадлежащих к Группе-1 (Н6, слева) и Группе-2 (Н14, справа). Представлены наиболее долгоживущие конформации гомотримеров, полученные при симуляциях молекулярной динамики в сэндвиче вода/циклогексан/вода. Полярные (Ser, Thr), алифатические (Val, Ile, Leu) и ароматические (Phe, Trp, Tyr) остатки обозначены голубым, оранжевым и коричневым цветом, соответственно. Сайты гидролиза субтилизином в составе тримера Н6 (Leu 186 & Tyr 189, см. Рис. 6, Б) покрашены зеленым. Сайты ацилирования (остатки цистеинов, связывающие стеарат) «смотрят» наружу. Примерные границы липидной мембраны (внешняя – ECTO, внутренняя – СТ) указаны горизонтальными линиями.

Для того чтобы оценить возможность участия остатков жирных кислот в образовании комплекса ТМ-доменов НА, мы провели предварительную работу по изучению данной липидной модификации, что будет рассмотрено в следующем разделе.

II. Липидная модификация белков – S-ацилирование.

1. Дифференциальное S-ацилирование – характерная черта «сливающих»

белков оболочечных вирусов.

1.1. Гемагглютинин (НА) природных штаммов вируса гриппа А.

Используя описанный выше подход анализа заякоривающих сегментов НА (см. Рис. 3), мы обнаружили, что С-концевая область НА ацилирована стехиометрически в составе вириона. Хотя в присутствии восстанавливающего реагента происходит частичное деацилирование пептидов за счет разрушения тио эфирной связи (Рис. 13, А), при проведении обработки вирионов цистеиновыми протеиназами в отсутствие тиолового реагента (с увеличением времени реакции), детектировали преимущественно трижды-ацилированные пептиды (Рис. 13, Б).

Оказалось также, что НА вируса гриппа А связывают не только остатки пальмитата (С 16:0), что было известно ранее, но также остатки стеарата (С 18:0).

Рис. 13. МС-анализ хлороформных экстрактов субвирусных частиц штамма A/Puerto Rico/8/34 (H1N1), полученных обработкой вирионов бромелаином в присутствии (А), либо отсутствие (Б) 50 мМ 2-меркаптоэтанола. Сдвиг массы пептида на 238 единиц соответствует присоединению пальмитата (Pal), а на 266 – стеарата (Str), m/z – отношение массы молекулярного иона к заряду.

Достоинством нашего метода является возможность количественно оценить относительную долю пальмитатов и стеаратов на основании обсчета серии масс спектров, что было проверено в ряде контрольных экспериментов. Долю пальмитатов рассчитывали по формуле:

РP=(I3P*100%+I2P1S*66,6%+I1P2S*33,3%)/(I3P+I2P1S+I1P2S+I3S), где I3P, I2P1S, I1P2S, I3S – интенсивности пиков пептидов, связавших 3 пальмитата, 2 пальмитата/ 1 стеарат, пальмитат/ 2 стеарата и 2 стеарата, соответственно. Доля стеаратов составляла РS=100%-РP.

Мы проанализировали более 40 штаммов, принадлежащих к двум эволюционным группам НА вируса гриппа А: Группе-1 (Н1-группа, антигенные подтипы Н1, Н2, Н5, Н6, Н8, Н9, Н11, Н12, Н13, Н16 и недавно обнаруженный Н17), либо Группе-2 (Н3-группа, подтипы Н3, Н4, Н7, Н10, Н14 и Н15). Гомология аминокислотных последовательностей внутри подтипа НА оценивается в 91-100%, между подтипами внутри одной эволюционной Группы 60-74%, а между подтипами, принадлежащими к разным Группам 40-44% (Air, 1981;

Nobusawa, 1993). Оказалось, что доля стеаратов у разных антигенных подтипов НА вируса гриппа А варьирует от 4 до 36% от общего пула связанных жирных кислот (Рис. 14).

Рис. Филогенетическое 14.

дерево, построенное по данным множественного выравнивания последовательностей С-концевых областей НА вируса гриппа А, принципиально не отличается от дерева, построенного для эктодоменов НА (Russell et al., Указаны антигенные 2008).

подтипы, принадлежащие к Группе 1 (Н1) и Группе-2 (Н3), а также доли стеаратов (равные 100% пальмитаты), связанных с НА штаммов человека, птицы, лошади (подтипы Н1, Н2, Н3);

свиньи (Н9);

птиц (остальные подтипы).

Обращает на себя внимание большая вариабельность количества стеаратов у НА подтипов Группы-1 по сравнению с Группой-2. Интересно также, что у штаммов подтипа Н9 (4% стеаратов), остаток цистеина, обычно локализованный на границе ТМ- и СТ-доменов, сдвинут на пять остатков ближе к С-концу и расположен, таким образом, строго в СТ-домене (Рис. 15). Это рождает гипотезу о том, что граница липидного бислоя может быть «молекулярным сигналом» для присоединения стеарата.

Штамм вируса гриппа А ТМ СТ % стеарат Duck/VietNam/342/2001 (H5N2) LESIGTYQILSIYSTVASSLALAIMVAGLSFWMСSNGSLQСRIСI 32.0±3. Swine/HK/9/98 (H9N2) LESEGTYKILTIYSTVASSLVIAMGFAAFLFWAMSNGSСRСNIСI 4.3±0. Рис. 15. Аминокислотные последовательности НА подтипов Н5 и Н9 и доля связанного стеарата (среднее значение ± SD;

остальное – пальмитат). Область ТМ домена подчеркнута. Ацилированные цистеины выделены заливкой.

Были обнаружены также различия в относительном содержании стеаратов между штаммами, изначально выделенными от разных хозяев: НА штаммов человека (подтипы Н1, Н2 и Н3) содержали, как правило, меньше стератов, чем НА штаммов птиц/млекопитающих. В чем причина обнаруженной закономерности, пока не ясно. Предложенная нами экспериментальная модель для исследования этого феномена будет рассмотрена в одном из следующих разделов.

МС/МС-анализ родительских ионов С-концевых фрагментов показал, что тио эфирная связь не разрывается раньше пептидной связи. Поэтому мы смогли локализовать остатки жирных кислот, присоединенные к различным остаткам цистеина, на масс-спектрах фрагментации. В случае штаммов человека подтипа Н (например, A/Puerto Rico/8/34 (H1N1), 12% стеаратов), на исходном масс-спектре доминировал трижды пальмитилированный вариант пептида. Масс спектр фрагментации такого иона обнаруживал сдвиги на 238 единиц (соответствующие присоединению остатков пальмитата) после каждого ацилированного остатка цистеина. Напротив, если фрагментации подвергали родительский ион пептида, несущего 2 пальмитата/ 1 стеарат, доминирующий у большинства штаммов вирусов птиц, то наблюдали сдвиг массы ацилированного остатка цистеина в ТМ-домене на 266 единиц (масса стеарата), в то время как массы двух других остатков цистеина, расположенных в СТ-домене, сдвигались на 238 единиц (Рис. 16).

Рис. 16. Фрагмент тандемного масс-спектра родительского иона (m/z 5533), соответствующего С-концевому пептиду НА вируса гриппа A/FPV/Rostock/34 (H7N1). Указана последовательность а.о., подтвержденная массами у-ионов. Сдвиг массы остатка Cys, расположенного в ТМ-домене, на 266 единиц соответствует присоединению стеарата. Два остатка Cys, расположенных в СТ-домене, связали пальмитаты Str-стеарат, Pal-пальмитат.

Хотя эти данные «показательны», они не доказывают однозначно локализацию стеарата исключительно на сайте ацилирования, расположенном на границе ТМ-и СТ-доменов. Поскольку фрагментации подвергается лишь небольшая часть пула молекул (примерно 10%), всегда можно возразить, что те пептиды, которые несут стеарат на одном из сайтов, локализованных в СТ-домене, по какой то причине не фрагментировали и не участвовали в составлении полной картины.

1.2. Мутанты НА вируса гриппа А с заменами сайтов ацилирования.

Для окончательной проверки гипотезы о локализации стеарата только на сайте ацилирования в ТМ-домене, мы провели серию экспериментов с рекомбинантными вирусами гриппа А, полученными методом реверсной генетики на основе штамма A/FPV/Rostock/34 (H7N1) (Wagner et al., 2005), содержащими НА с одиночными заменами остатков цистеина на остатки серина (Рис. 17, Табл. 3).

Рис. 17. Анализ характера ацилирования вируса A/FPV/Rostock/34 (H7N1) дикого типа (wt) и рекомбинантов Ac1, Ac2, Ac3. А: Схема аминокислотной последовательности С концевой области НА, включающей ТМ-домен (подчеркнуто) и СТ-домен, с указанием места расщепления бромелаином и замен остатков Cys на Ser у мутантов Ac1, Ac2 и Ac3. Б: Масс спектры органической фазы после экстракции субвирусных частиц. Указаны первый и последний а.о. выделенных пептидов и число связанных остатков ж.к.

Таблица 3. Данные МС-анализа S-ацилирования НА дикого штамма A/FPV/Rostock/34 (H7N1) и рекомбинантных вирусов Ac1, Ac2, Ac3.

Идентифицированные Жирные кислоты (%)** Вирус аминокислотные Pal Stear остатки* A/FPV/Rostock/34 (H7N1) HA 520-563 69.9±0.4 30.1±0. FPV/AC1 HA 520-563 96.0±1.6 4.0±1. FPV/AC2 HA 520-563 54.0±0.4 46.0±0. FPV/AC3 HA 520-563 54.0±1.2 46.0±1. *Подтверждено тандемной МС.

**Результаты представлены в виде: среднее значение ± стандартное отклонение (SD);

проанализировано 2-3 выращивания вируса, для каждого из которых проведено 2- обработки ферментом и обсчитано по 4-5 масс-спектров.

Как видно на Рис. 17, Б, пик пептида, связавшего 2 пальмитата/1 стеарат, практически отсутствует на масс-спектре мутанта АС1. Таким образом, НА, у которого нет сайта ацилирования в ТМ-домене (практически) не связывает стеараты (их всего 4%, Табл. 3). Напротив, у мутантов Ас2 и Ас3, лишенных одного из цистеинов в СТ-домене, доля стеаратов повысилась с одной трети до половины общего количества связанных жирных кислот. Таким образом для НА вируса гриппа А была подтверждена гипотеза о приоритетной локализации остатка стеарата на остатке цистеина, расположенном на границе ТМ- и СТ-доменов.

1.3. НА вируса гриппа В и HEF вируса гриппа С.

В случае вируса гриппа В в последовательности НА эволюционно сохранены только два сайта ацилирования, локализованные в СТ, а в случае гомологичного белка гемагглютинин-эстераза-фьюжен (HEF) вируса гриппа С присутствует только один сайт ацилирования в ТМ-домене (Рис. 18). Мы обнаружили, что НА вируса гриппа В связывает исключительно пальмитаты, в то время как единственный цистеин белка HEF ацилирован преимущественно стеаратами (Рис. 18, Табл. 4).

Рис. 18. Анализ S-ацилирования гликопротеинов вирусов гриппа В и С. А:

Аминокислотные последовательности НА/HEF с указанием сайтов расщепления бромелаином (стрелки) и остатков цистеина – сайтов ацилирования. Б: Масс-спектры органических экстрактов субвирусных частиц. Str-стеарат, Pal-пальмитат. Указаны первый и последний а.о. выделенных пептидов и число связанных остатков ж.к.

Таблица 4. Данные МС-анализа S-ацилирования HA/HEF вирусов гриппа В/С.

Идентифицированные Жирные кислоты (%)** Вирус аминокислотные Pal Stear остатки* B/Victoria/2/87 HA 541-585 97.6±0.9 2.4±0. C/Johannesburg/1/66 HEF 616-655 12.1±1.3 87.9±1. *,** Аналогично Таблице 3.

Таким образом, поскольку число и тип связанных остатков жирных кислот различаются у вирусов гриппа А, В и С, можно предсказать принадлежность неизвестного штамма вируса к одному из трех типов по данным анализа характера S ацилирования с помощью Рис. 19. Схема сайт-специфического характера S-ацилирования белков HA и разработанного нами подхода HEF вирусов гриппа А, В и С в составе (Рис. 19). мембраны вириона.

1.4. Белки других оболочечных вирусов.

Ранее высказывалось предположение, что стеарат присоединяется преимущественно к трансмембранным белкам, которые имеют короткий заряженный цитоплазматический домен, такой как у HEF вируса гриппа С и белка Е1 вируса болезни Семлики (SFV) (2-3 а.о.), с тем, чтобы «уравновесить» гидрофобность этой области (Veit et al., 1996). Наши данные МС-анализа, полученные для НА вируса гриппа А, говорили о том, что сигналом для присоединения стеарата может быть граница липидного бислоя. Чтобы разобраться с этими альтернативными гипотезами, мы подобрали несколько белков из разных групп оболочечных вирусов, которые различались положением цистеина - сайта ацилирования по отношению к границе липидного бислоя, а также длиной цитоплазматического домена (Рис. 20).

VSV G …GWFSSWKSSIASFFFIIGLIIGLFLVLRVGIYLСIKLKHTKKRQIYTDIEMNRLGK NDV F …VKLTSTSALITYIVLTVISLVFGVLSLVLAСYLMYKQKAQQKTLLWLGNNTLDQMRATTKI SFV E1 …MSGTALSWVQKISGGLGAFAIGAILVLVVVTСIGLRR SFV E2...YYGLYPAATVSAVVGMSLLALISIFASСYMLVAARSKСLTPYALTPGAAVPWTLGILССAPRAHA вирус белок ТМ СТ Рис. 20: Аминокислотные последовательности ТМ- (подчеркнуто) и СТ-доменов различных вирусных белков. Ранее идентифицированные остатки Cys, связывающие остатки жирных кислот, выделены заливкой. VSV G: G-белок вируса везикулярного стоматита, NDV F: сливающий (F) белок вируса болезни Ньюкасла;

E1 и E2: белки тогавируса - вируса леса Семлики (SFV).

Вирусы были выращены в куриных эмбрионах (NDV), либо культуре клеток почки хомяка ВНК (VSV, SFV). Используя протеолиз вирионов бромелаином (VSV, NDV), либо сериновой протеиназой субтилизином Карлсберг, с последующей экстракцией гидрофобных пептидов из обработанных ферментом вирионов и МС анализом, мы показали, что белок Е1 вируса леса Семлики (SFV) связывает стеарат, а белок Е2 SFV гетерогенно ацилирован пальмитатами и стеаратом (стеарат, по косвенным экспериментальным данным, связывается с остатком цистеина в ТМ домене (Рис. 21, Табл. 5).

Рис. 21. Анализ характера ацилирования гликопротеинов E1 и E2 вируса SFV. A:

последовательности а.о. с указанием сайтов расщепления бромелаином (стрелки). Б:

вирионы до (-) и после (+) обработки бромелаином. В, Г: МС-анализ. Указаны первый и последний а.о. идентифицированных пептидов и количество/тип связанных ж.к.

Таблица 5. Данные МС-анализа S-ацилирования трансмембранных белков вирусов VSV, NDV, SFV.

Белок, Жирные кислоты (%)** Вирус идентифицированные Pal Stear аминокислотные остатки NDV F 497-553* 3.4±0.8 96.6±0. VSV G 460-491* 91.7±2.2 8.3±2. E1 406-438 13.8±5.7 86.2±5. SFV E2 342-422* 67±0.7 33±0. SFV *, ** Аналогично Таблице 3.

Далее, анализ экстрактов из субвирусных частиц (СВЧ) вируса везикулярного стоматита (VSV) показал, что белок G содержит пальмитат, ковалентно связанный с остатком цистеина, локализованным в СТ-домене длиной 29 а.о. (Рис. 22, Табл. 5).

Напротив, белок F вируса болезни Ньюкасла (NDV) был стехиометрически ацилирован остатками стеарата (Рис. 23, Табл. 5), хотя длина СТ-домена этого белка примерно такая же (26 а.о.).

Рис. 22. Анализ характера ацилирования гликопротеина G вируса VSV. A-В – аналогично Рис. 21. Г: МС/МС анализ иона, обозначенного рамкой на панели В. Сдвиг массы Cys489 на 238 единиц указывает на присоединение пальмитата.

Рис. 23. Анализ характера ацилирования гликопротеина F вируса NDV. A:

последовательности а.о. с указанием сайтов расщепления бромелаином (стрелки). Б:

вирионы (левая электрофореграмма), либо экстрагированный из вирионов неионным детергентом Айгепал (Igepal) гликопротеин F (правая электрофореграмма) до (-) и после (+) обработки бромелаином. В: МС-анализ. Указаны первый и последний а.о.

идентифицированных пептидов и количество/тип связанных ж.к. Г: МС/МС анализ иона, обозначенного рамкой на панели В. Сдвиг массы Cys523 на 266 единиц указывает на присоединение стеарата.

Таким образом, из наших экспериментов следует, что не длина внутривирионного домена, но расположение сайта ацилирования относительно границы липидного бислоя определяет выбор типа модифицирующего остатка у гликобелков оболочечных вирусов разных семейств. В предположении, что реакция ацилирования вирусных белков осуществляется ферментативно, как это происходит в случае белков клетки (Jennings & Linder, 2012), должны, вероятно, существовать разные ферменты, переносящие и прикрепляющие пальмитат, либо стеарат.

2. Анализ биологической значимости S-ацилирования – новые подходы.

Лабораторные реассортанты экспериментальная модель для 2.1. исследования влияния других белков вириона на S-стеарилирование гемагглютинина вируса гриппа А.

Как было отмечено во вступлении, данные о функции модифицирующих остатков жирных кислот достаточно противоречивы. Тем более, вопрос о структурной роли/ функциональной значимости дифференцированного ацилирования пальмитатами и стеаратом, ранее просто не возникал. Хотя стеарат, как было показано выше, присоединяется исключительно к сайту ацилирования, локализованному на границе трансмембранного и цитоплазматического доменов, эта позиция в случае НА вируса гриппа А также может быть (частично) занята пальмитатом. Имеются в виду штаммы, у которых суммарная доля связанных с НА стеаратов составляет не одну треть (30-35%), а 10-20% от общего пула связанных жирных кислот (при условии присутствия трех ацилированных остатков цистеина).

В случае НА подтипов Н1, Н2, Н3, для которых были проанализированы последовательности как штаммов человека, так и птиц/млекопитающих, была обнаружена интересная тенденция снижения относительного количества связанного с НА стеарата в случае «человеческих» штаммов по сравнению со штаммами птицы/лошади (см. Рис. 14). Отметим, что для наших экспериментов все вирусы выращивались стандартно в 10-11-дневных куриных эмбрионах. Вариации аминокислотной последовательности С-концевых сегментов у сравниваемых белков были незначительны или отсутствовали вовсе. Так, они были идентичны у НА штаммов A/Duck/Alberta/35/76 (H1N1) и A/USSR/90/77 (H1N1), но доли связанных стеаратов различались почти в 2 раза (Табл. 6). Поэтому мы предположили возможное влияние других вирусных белков на S-стеарилирование НА при формировании вирусных частиц.

Таблица 6. Последовательности С-концевых сегментов НА, количество связанных стеаратов и различающиеся позиции аминокислотных остатков в белке М1 у двух штаммов вируса гриппа А.

Штамм вируса С-сегмент НА: ТМ СТ % стеарата а.о. в M 121 A/Dk/Alberta/35/76(H1N1) LESMGVYQILAIYSTVASSLVLLVSLGAISFWMCSNGSLQCRICI 18.3±0.7 Thr Thr Ala LESMGVYQILAIYSTVASSLVLLVSLGAISFWMCSNGSLQCRICI 11.7±0.7 Ala A/USSR/90/77(H1N1) Согласно косвенным данным (ко-экстракция неионным детергентом на холоду, ко-локализация при конфокальной микроскопии, биофизические измерения), М белки могут взаимодействовать с С-концевым сегментом НА в составе оболочки вириона. Поскольку физико-химическая природа подобных взаимодействий – вопрос полностью открытый, нельзя исключить участие в образовании белковых комплексов остатков жирных кислот, связанных с НА. Тем более, что белок М1 присутствует в клетке в эндоплазматическом ретикулуме и аппарате Гольджи (Ali et al., 2000;

Thaa et al., 2009) – компартментах, где происходит пост-трансляционное S-ацилирование НА (Veit et al., 1993). Было высказано предположение о том, что возможна некая функциональная «связка» между S-ацилированием НА и структурой белка М1 (Chen et al., 2005). При элиминации сайтов ацилирования методом мутагенеза в молекулах НА штамма A/Udorn/72 (Н3N2) наблюдали ухудшение взаимодействия НА с М1 в тесте ко-экстракции на холоду. Данная недостаточность по ацилированию могла быть скомпенсирована при введении в систему белка М1 другого штамма вируса Далее, поскольку НА и мембранный белок М2 обнаружены в основании выпочковывающихся филаментозных вирусных частиц (Rossmann, 2010), вероятно, они могут взаимодействовать друг с другом. Кластеризация НА и М2 в отсутствие других белков была недавно показана биофизической методикой, использующей «перенос резонансной энергии между флуорофорами» (Fluorescence Resonance Energy Transfer, FRET) для оценки малых расстояний ( 10 нм) между молекулами (Thaa et al., 2010). Ковалентно связанные остатки жирных кислот могли быть вовлечены (непосредственно или косвенно) в эти взаимодействия. Ранее также было описано наличие нескольких эволюционно устойчивых «хозяин-специфичных»

а.о. в белках М1 и М2 (три и семь различий, соответственно) (Reid et al., 2002;

Furuse et al., 2009), из которых интересными (потенциально влияющими на 3D-структуру) кажутся замены Thr121Ala и Thr137Ala, локализованные в М-домене белка М1 (Табл.

6), а также замены во внутривирионном домене белка М2: Phe55Leu, Lys78Gln, Ala86Val.

Наконец, существует большой цикл работ о функциональной взаимозависимости двух поверхностных гликопротеинов – НА и NA (Rudneva et al., 1993;

Kaverin et al., 2000;

Ilyushina et al., 2005). Гипотетически, баланс НА-NA, который способствует эффективному распространению вируса от клетки к клетке, может быть реализован на уровне не только эктодоменов гликобелков, но и их заякоривающих сегментов.

Чтобы понять, вовлечены ли М-белки или нейраминидаза в процесс S-ацилирования НА, мы разработали экспериментальную модель с использованием набора лабораторных реассортантных клонов. Поверхностные белки (NA и/или НА) происходили от штаммов птиц, а донорами внутренних белков, включая были штаммы M-белки, человека (Рис. 24).

Рис. 24. Схема реассортации генов.

А: Родительские штаммы;

Б: Реассортанты, взятые для анализа.

Подбирая реассортанты для последующего МС-анализа количества связанного с НА стеарата, мы руководствовались несколькими критериями (Табл. 7):

(1) с целью оценки вклада NA параллельно исследовали двугенный реассортантный клон, в котором и НА, и NA происходили от родительского «птичьего» вируса, и моногенный (только НА от «птичьего» вируса, а остальные белки, включая NA, от штамма человека);

(2) чтобы снизить возможность структурной «несовместимости», донорами НА были выбраны как представители эволюционной Группы 1 (подтипы Н2, Н5), так и Группы 2 (Н3, Н4, Н10);

(3) для улучшения «совместимости» генов М белков с генами поверхностных гликобелков (Scholtissek et al., 2002) донорами внутренних белков был выбран либо вирус A/Puerto Rico/8/34 (H1N1), либо A/USSR/90/77 (H1N1), поскольку эти штаммы содержат гены матриксных белков, относящихся к разным филогенетическим ветвям (Furuse et al., 2009).

Таблица 7. Генный состав реассортантов и связанный с НА стеарат по данным МС.

Гены* №№ Стеарат(%)** Вирусы п/п другие HA NA M 1 22.0±1. A/Dk/Ukraine/63(H3N2) Duck-U Duck-U Duck-U Duck-U 24.1±1. R1(H3N1) Duck-U USSR USSR USSR 25.5±1. R3(H3N2) Duck-U Duck-U USSR USSR 2 22.8±0. A/Duck/Czech/56(H4N6) Duck-C Duck-C Duck-C Duck-C 20.0±1. RCB1(H4N1) Duck-C USSR USSR USSR 21.2±0. RCB9(H4N6) Duck-C Duck-C USSR USSR 3 23.7±0. VNH5N1-PR8/CDC-RG (H5N1) Viet Nam Viet Nam PR8 PR 23.7±0. VN-SW(7)(H5N2) Viet Nam Swine Swine Swine 23.4±0. VN-SW(13)(H5N2) Viet Nam Swine PR8 Swine 4 23.9±0. A/Pintail/Primorie/695/76(H2N3) Pintail Pintail Pintail Pintail 23.3±1. PX8(H2N1) Pintail USSR PR8 PR 5 26.6±0. A/Dk/Primorie/2621/01(H5N2) Duck-P Duck-P Duck-P Duck-P 29.4±0. R22/II(H5N1) Duck-P PR8 PR8 PR 29.3±0. R22(H5N2) Duck-P Duck-P PR8 PR 6 27.3±0. A/Dk/Ho Chi Minh/014/78(H5N3) Duck-H Duck-H Duck-H Duck-H 28.3±0. R1(2)(H5N3) Duck-H Duck-H USSR USSR 7 35.1±0. A/Chick/Germany/N/49(H10N7) Chick-G Chick-G Chick-G Chick-G a 36.6±1. RG1(H10N1) Chick-G USSR USSR USSR * Pintail – гены от вируса A/Pintail/Primorie/695/76 (H2N3);

USSR - A/USSR/90/77 (H1N1);

PR8 A/Puerto Rico/8/34 (H1N1);

Duck-P - A/Duck/Primorie/2621/01 (H5N2);

Duck-H - A/Duck/Ho Chi Minh/014/78 (H5N3);

Duck-U - A/Duck/Ukraine/63 (H3N2);

Duck-C - A/Duck/Czechoslovakia/ (H4N6);

Chick-G - A/Chicken/Germany/N/49 (H10N7);

Viet Nam - A/Viet Nam/1203/04 (H5N1);

Swine - A/Swine/Hong Kong/9/98 (H9N2) ** Пальмитат = 100% - стеарат;

результаты представлены в виде среднее ± SD.

В-четвертых, доли связанных с НА стеаратов в составе родительских штаммов птиц – доноров поверхностных белков – (22-35%) превышали в 2-3 раза аналогичный параметр у «человеческих» штаммов – доноров внутренних белков (12 13%). Поэтому предполагаемое снижение доли стеаратов, связанных с НА в составе реассортантного клона, по сравнению с НА родительского штамма птиц, могло быть надежно обнаружено с помощью нашего подхода. Наконец, в одной из групп (№3 в Табл. 7) в качестве донора NA и HA был использован не «птичий» штамм, а рекомбинантный вирус включающий ген НА VNH5N1-PR8/CDC-RG (H5N1), высокопатогенного штамма A/Viet Nam/1203/04 (H5N1) с удаленным поли-основным протеолитическим сайтом между цепями НА1 и НА2, а гены внутренних белков происходили от штамма A/Puerto Rico/8/34 (H1N1) (рекомбинант был любезно предоставлен профессором Р. Донисом из Центра по надзору за гриппом в США (CDC, Атланта)). В серии последующих реассортаций в качестве донора внутренних белков был использован штамм A/Swine/Hong Kong/9/98 (H9N2), HA которого связывает лишь 4% стеаратов (наименьшее количество среди штаммов вируса гриппа А). В случае существования негативного воздействия внутренних белков этого штамма на S-стеарилирование HA подтипа Н5 (связывающего 24% стеаратов), эффект должен был быть значительным. Следует отметить, что клон VN-SW(7) содержал все гены (кроме НА) «свиного» штамма, в то время как тройной реассортант VN-SW(13) содержал М-белки вируса A/Puerto Rico/8/34 (H1N1) на том же генетическом фоне. Это давало возможность оценить вклад матриксных и остальных внутренних белков вириона отдельно.

В Таблице 7 представлены сравнительные данные МС о стеаратах, ковалентно связанных с молекулами НА в составе штаммов – доноров НА/NA - и реассортантных клонов, начиная с наименьшего (22%) и заканчивая наибольшим (35%) количеством стеарата, обнаруженным у родительского НА. Флуктуации долей стеаратов составили 0-3.5%, причем в большинстве случаев они были выше у реассортантного, чем у «птичьего» родительского НА (в противоположность нашей исходной гипотезе). Различия между моногенными и двугенными реассортантами практически отсутствовали. Также не было принципиальной разницы при использовании разных штаммов (человеческих и свиного) в качестве доноров внутренних белков вириона. Уменьшение доли стеаратов у моногенного и двугенного реассортантов подтипа Н4 по сравнению с исходным вирусом A/Duck/Czechoslovakia/56 (H4N6) на 2.8% (P0.001, t-test) и 1.6% (P0.01), соответственно (см. группу №2 в Табл. 7), представляет собой единственный случай, говорящий в пользу нашей исходной гипотезы. Однако, столь малые различия, по-видимому, не являются функционально значимыми.

В целом, в рамках использованной экспериментальной модели не было обнаружено существенных различий ни в стехиометрии S-ацилирования, ни в S стеарилировании НА в составе родительских штаммов птиц и реассортантов. Мы заключаем, что отсутствует существенное влияние других белков вириона на липидную модификацию НА.

2.2. Синтетический пептид, имитирующий S-ацилированный С-концевой сегмент НА, – модель для исследования структурной роли остатков связанных жирных кислот.

Для исследования структурной роли липидной модификации мы предложили еще одну модель. В сопряженной бесклеточной системе синтеза (СБСС) на базе экстракта из E. coli по отработанной ранее технологии для синтеза мембранных рекомбинантных белков (Khabibullina et al., 2010, Mineev et al., 2011) был получен синтетический пептид, последовательность которого соответствовала 46 а.о. С концевой области НА штамма A/FPV/Rostock/34 (H7N1) и включала линкер, ТМ- и СТ-домены (HA-TMД-CT, Рис. 25, А). N-концевой остаток формил-метионина был введен в качестве сигнала для начала биосинтеза.

Рис. 25. Синтезированные пептиды. А: Пептид HA-TMД-CT включает остаток формил метионина в позиции 1 и С-концевую последовательность НА A/FPV/Rostock/34 (H7N1) – остатки 2-47. Б: Пептид с заменой свободного остатка Cys в позиции 21 (HA-TMДC21S-CT), трижды алкилированный гексадециловыми цепями по сайтам ацилирования. ТМ-домен подчеркнут. Присоединение трех алкильных цепей к пептиду подтверждено МС и ЯМР.

После проведения синтеза реакционную смесь центрифугировали на настольной центрифуге, после чего искомый пептид обнаруживали в осадке (Рис. А, стрелка). синтезировали, полностью заменяя N-меченый HA-TMД-CT аминокислоты в реакционной и питающей смеси N-альгальными аминокислотами (IsotecTM). Оптимальной оказалась конечная концентрация 3.1 мг/мл.

Далее, для имитации S-ацилирования трех C-концевых остатков цистеина остатками жирных кислот, было предложено алкилировать три остатка цистеина (сайта ацилирования) длинными алифатическими цепями, идентичными остатку пальмитата (С 16:0). Для этого сначала синтезировали пептид с заменой внутреннего свободного остатка цистеина 21 на остаток серина (HA-TMДC21S-CT) аналогично исходному пептиду Оставшиеся три свободных HA-TMД-CT. SH-группы алкилировали, используя реагент гексадецил-метантиосульфонат (Hd-MTS), с образованием дисульфидной связи (Рис. 25, Б). Модификацию реагентом Hd-MTS контролировали с помощью МС и ЯМР. Инкубация пептида в течение ночи с двукратным молярным избытком реагента приводила к алкилированию 86% свободных SH-групп, а после инкубации с 10-кратным избытком Hd-MTS в течение ч было достигнуто практически стехиометрическое алкилирование (91-92%).

Рис. 26. А: Электрофоретический анализ и окрашивание Кумасси синтезированного в бесклеточной системе пептида HA-TMД-CT при различных концентрациях 15N-алгаль аминокислот (1.6, 3.1, 6.3 мг/мл). Дорожки: 1 – маркеры;

2, 5, 8, 11 – реакционная смесь после синтеза;

3, 6, 9, 12 – растворимая фракция после центрифугирования;

4, 7, 10, 13 – нерастворимая фракция. Контрольный синтезированный зеленый флуоресцентный белок обнаруживали практически только в растворимой фракции (дорожка 3 в блоке GFP). Белок с ориентировочной массой 5 kДa, соответствующий пептиду HA-TMД-CT (стрелка), находили в осадке (7, 10, 13). Б: 1H, 15N-HSQC спектры немодифицированного HA-TMД-CT пептида (серые сигналы) и алкилированного HA-TMДC21S-CT (черные), растворенных в гексафторизопропаноле. Смещение лишь нескольких сигналов показывает, что алкилирование не влияет существенно на конформацию пептида.

Полученные пептиды удалось перевести из осадка в растворенное состояние только с использованием гексафторизопропанола (HFIP). Спектроскопия ЯМР показала, что синтезированные пептиды достаточно чистые. Однако набор сигналов от немодифицированного и трижды алкилированного пептидов, растворенных в HFIP, был примерно одинаков (Рис. 26, Б). Дальнейшие структурные исследования пептидов, встроенных в липидные мицеллы (DPC или LMPG) или бицеллы (DMPC/DHPC = 1:2.5), имитирующие липидную мембрану, однако, были осложнены олигомеризацией пептидов и агрегацией пептид-содержащих бицелл. Поскольку ТМ домены сливающих белков образуют олигомеры в оболочке вириона, что несет функциональную нагрузку при слиянии вирусной и клеточной мембран, тенденция к агрегации, по-видимому, не являлась артефактом.

Чтобы проанализировать вторичную структуру синтетических пептидов, мы встроили их в большие бислойные липосомы с микросомальным составом липидов фосфолипидов (фосфатидилхолин фосфатидилсерин (70% : = 2:1), 30% холестерина). Встраивание контролировали по флуоресценции триптофана (характерный пик при 331 нм, Рис. 27, А) и спектрам поглощения при 280 нм, которые позволили ориентировочно определить концентрацию встроенных пептидов.

Оказалось, что менее 10% использованных пептидов вошли в состав везикул. Анализ с помощью спектроскопии кругового дихроизма (КД) немодифицированного HA TMДC21S-CT и трижды алкилированного Hd-HA-TMДC21S-CT пептидов, встроенных в липосомы, выявил два минимума при ~ 208 нм и 220 нм и положительный сигнал в районе 195 нм, что является типичными чертами -спиральной вторичной структуры (Рис. 27, Б). Ранее -спиральная конформация была показана только для пептида с последовательностью ТМ-домена НА подтипа Н3 (30 а.о., Tatulian & Tamm, 2000).

Рис. 27. Флуоресценция и КД-спектроскопия немодифицированного (сплошные линии) и алкилированного (пунктир) пептидов, встроенных в бислойные везикулы.

(А): Спектры флуоресценции триптофана в составе пептида HA-TMД-CT. Эмиссию флуоресценции измеряли в условных единицах (у.е.) при длинах волн от 300 до 450 нм. (Б):

Спектры КД пептидов HA-TMДC21S-CT и Hd-HA-TMДC21S-CT за вычетом спектров контрольных липосом. Показана суммарная нормированная эллиптичность (измеренная в милли-градусах изменения поляризации света). Два минимума при ~ 208 и 220 нм указывают на наличие -спиральной вторичной структуры. Анализ проведен доктором Людвигом Краббеном, Свободный Университет Берлина, Германия (Dr. Ludwig Krabben, Free University Berlin, Germany).

Таким образом, ни ЯМР-, ни КД-спектроскопия не выявили существенной разницы между немодифицированным и алкилированным пептидами. Сдвиг на спектре КД одного из минимумов в случае алкилированного пептида (208 214 нм) может указывать на небольшие локальные конформационные изменения, например, искривление -спирали, либо некоторую олигомеризацию/ агрегацию пептида.

Однако главной характерной чертой как модифицированного, так и немодифицированного пептидов остается присутствие -спиральных структур. Это говорит о том, что гидрофобная модификация пептида не влияет значительно на вторичную структуру пептида, включающего трансмембранный, линкерный и внутривирионный домены НА. Сходный вывод сделан на основании данных молекулярной динамики пальмитилированного белка калнексина в модельных липидных бислоях (Lakkaraju et al., 2012). Остатки жирных кислот, связанные с сайтами на границе ТМ- и СТ-доменов, не влияли на вторичную структуру ТМ домена, а определяли ориентацию СТ-домена относительно оси ТМ-домена.

Далее мы остановимся на возможном участии остатков связанных стеаратов в гомотримерной организации ТМ-доменов НА.

Остатки стеарата участвуют в тонкой регуляции III.

пространственной упаковки гомотримера ТМ-доменов?

На Рис. 28 представлена схема, обобщающая данные по протеолизу НА в составе гомотримеров и S-стеарилированию.

Рис. 28. Гипотетическая схема участия остатков жирных кислот в тримерной ассоциации TM-доменов НА у разных эволюционных групп вируса гриппа А и вируса гриппа В. Указаны исследованные антигенные подтипы вируса гриппа А. Альфа-спирали ТМ-доменов обозначены серыми прямоугольниками, которые в разной степени диссоциируют в N-концевой области после удаления эктодомена ферментом. Длина стрелок примерно соответствуют разной «глубине» гидролиза ТМ-доменов ферментами. «Бр» бромелаин, «субт» – субтилизин. Черный зигзаг – пальмитат, белый зигзаг – стеарат, черно белый зигзаг – смесь двух типов жирных кислот Мы полагаем, что ТМ-домены НА вируса гриппа А/Группы-2 упакованы наиболее плотно среди исследованных вирусов (т.к. ни один из модельных ферментов не гидролизует внутреннюю поверхность гомотримера ТМ-доменов).

Именно из-за того, что ассоциация плотная, мы не можем «вычленить» участие в ней остатков жирных кислот С другой стороны, НА вируса гриппа А/Группы- организованы менее плотно (ТМ-домены гидролизуются субтилизином). При этом обнаружено, что менее стеарилированные НА (4, 10, 20% стеаратов у подтипов Н9, Н1, Н2, соответственно) гидролизуются «глубже» в ТМ-домене (см. Рис. 6, Б), чем НА, у которых сайт ацилирования в ТМ-домене полностью занят стеаратом (30-35% подтипы Н5, Н6, Н12, Н13, Н16;

25% - подтип Н11, у которого 4 сайта ацилирования).

Наиболее «рыхло» по нашим данным олигомеризуются ТМ-домены НА вируса гриппа В (они гидролизуются не только субтилизином, но и бромелаином). Не исключено, что это связано с полным отсутствием у НА вируса В связанного остатка стеарата (Рис. 28).

Таким образом, мы постулируем, что остатки жирных кислот, связанные с сайтом ацилирования в ТМ-домене (стеараты – в большей степени), участвуют в стабилизации гомотримерного комплекса ТМ-доменов. Вероятно также, что различное соотношение пальмитат/стеарат может в некоторой степени обеспечивать тонкую регуляцию пространственной упаковки ТМ-доменов.

На Рис. представлены результаты картирования гидрофильных/ гидрофобных свойств – т.н. молекулярного гидрофобного потенциала (МГП) поверхности -спиралей ТМ-доменов представителей НА подтипов Н6 и Н14 и оценки их «шероховатости» (ландшафт) (оригинальные методики разработаны коллективом авторов в Лаборатории биомолекулярного моделирования ИБХ РАН под руководством профессора Р.Г. Ефремова). Данные, представленные на левой панели Рис. 29, позволяют «визуализовать» гидрофобные/гидрофильные свойства -спиралей, образуемых ТМ-доменами НА, а представленные на правой панели – их топографию. Видны существенные различия между свойствами -спиралей в случае подтипов Н6 и Н14. Так, обширная гидрофильная область в N-концевой (обращенной к эктодомену) области -спирали ТМ-домена НА подтипа Н6 (а.о. Ala3, Ser6, Thr7, Ser 9, Ser10, Ser11), отсутствует в случае подтипа Н14. Это область гидролизуется субтилизином у НА подтипов Группы-1. Далее, гидрофильный «канал», образуемый в С-концевой области модели Н6 аминокислотными остатками Ala20, Gly16 и Ser9, вероятно, может «вместить» остаток стеарата, связанный с Cys26, при условии его расположения вдоль трансмембранной -спирали. Такая локализация стеарата будет способствовать стабилизации тримера ТМ-доменов в условиях гидрофобного окружения липидного бислоя, в который погружен комплекс ТМ-доменов in situ.

Рис. 29. Свойства гидрофобности/гидрофильности (левая панель) и ландшафт (правая панель) доступной раствору поверхности (SAS) мономера ТМ-домена, рассчитанные для последовательностей НА подтипов Н6 и Н14. Поверхности спиралей спроецированы на цилиндр и представлены в виде двумерных карт (угол поворота относительно оси спирали указан по оси абсцисс, а высота спирали – по оси ординат).

Карты раскрашены согласно приведенным шкалам. Значения МГП рассчитаны в системе октанол/вода и представлены в логарифмической шкале.

ВЫВОДЫ Предложен новый подход изучения структурных свойств надмолекулярного 1.

комплекса линкерных последовательностей - «ножки» «шипа» гемагглютинина вируса гриппа. Выявлены тип/субтип-специфичные особенности ее архитектуры.

Разработана методология исследования упаковки трансмембранных доменов 2.

поверхностных белков в составе природных олигомеров. Впервые обнаружены принципиальные различия гомотримерной ассоциации трансмембранных доменов у гемагглютининов, принадлежащих к эволюционной Группе-1 (Н1-Группа) и Группе- (Н3-Группа) вируса гриппа А.

Сформулирована концепция о дифференциальном S-ацилировании остатками 3.

пальмитата и стеарата поверхностных белков оболочечных вирусов. Стеарат локализован исключительно на остатке цистеина, расположенном на границе трансмембранного и цитоплазматического доменов, в то время как сайты в цитоплазматическом домене модифицированы пальмитатами.

Разработана биотехнологическая платформа для типирования и 4.

субтипирования гемагглютинина, основанная на выявленных закономерностях характера S-ацилирования у более чем 40 исследованных штаммов вируса.

Предложен ряд экспериментальных моделей для изучения структурной и 5.

биологической значимости вирусных белков. С помощью S-ацилирования разработанных моделей показано, что гидрофобная модификация, имитирующая S ацилирование, не меняет вторичную структуру С-концевого сегмента гемагглютинина в липидном бислое. Другие вирусные белки (включая нейраминидазу, белки М1 и М2) не влияют на S-стеарилирование гемагглютинина в процессе морфогенеза вирионов.

На основании экспериментальных данных и результатов компьютерного 6.

моделирования выдвинута гипотеза о том, что остатки жирных кислот могут стабилизировать гомотримерную структуру трансмембранных доменов гемагглютинина вируса гриппа в мембранном окружении и участвовать в тонкой регуляции пространственной упаковки комплекса.

СПИСОК ОСНОВНЫХ РАБОТ, ОПУБЛИКОВАННЫХ ПО ТЕМЕ ДИССЕРТАЦИИ Статьи в рецензируемых научных журналах, рекомендованных ВАК РФ:

1 Mineev K.S., Lyukmanova E.N., Krabben L., Serebryakova M.V., Shulepko M.A., Arseniev A.S., Kordyukova L.V., Veit M. Structural investigation of Influenza virus hemagglutinin membrane-anchoring peptide // Protein Engineering, Design, and Selection. 2013. V. 26. P. 547-552.

2 Veit M., Serebryakova M.V., Kordyukova L.V. Palmitoylation of influenza virus proteins // Biochemical Society Transactions. 2013. V. 41. P. 50-55.

3 Serebryakova M.V., Kordyukova L.V., Rudneva I.A., Kropotkina E.A., Veit M., Baratova L.A. Mass spectrometry analysis of influenza virus reassortant clones does not reveal an influence of other viral proteins on S-acylation of hemagglutinin // Archives of Virology. 2013. V. 158. P. 467-472.

Кордюкова Л.В., Серебрякова Л.В. Масс-спектрометрические подходы в изучении оболочечных вирусов: новые возможности для структурной биологии и профилактической медицины // Биохимия. 2012. Т. 77. № 8. С. 1002-1016.

5 Serebryakova M.V., Kordyukova L.V., Semashko T.A., Ksenofontov A.L., Rudneva I.A., Kropotkina E.A., Filippova I.Y., Veit M., Baratova L.A. Influenza virus hemagglutinin spike neck architectures and interaction with model enzymes evaluated by MALDI-TOF mass spectrometry and bioinformatics tools // Virus Research. 2011. V.

160. P. 294-304.

6 Kordyukova L.V., Serebryakova M.V., Polyansky A.A., Kropotkina E.A., Alexeevski A.V., Veit M., Efremov R.G., Filippova I.Y., Baratova L.A. Linker and/or transmembrane regions of influenza A/Group-1, A/Group-2, and type B virus hemagglutinins are packed differently within trimers // Biochimica et Biophysica Acta.

201. V. 1808. P. 1843-1854.

7 Kordyukova L.V., Serebryakova M.V., Baratova L.A., Veit M. Site-specific attachment of palmitate or stearate to cytoplasmic versus transmembrane cysteines is a common feature of viral spike proteins // Virology. 2010. V. 398. P. 49-56.

8 Shishkov A.V., Bogacheva E.N., Dolgov A.A., Chulichkov A.L., Knyazev D.G., Fedorova N.V., Ksenofontov A.L., Kordyukova L.V., Lukashina E.V., Mirsky V.M., Baratova L.A. The in situ structural characterization of the influenza A virus matrix M protein within a virion // Protein and Peptide Letters. 2009. V. 16. P. 1407-1413.

9 Smirnova Y.A., Fedorova N.V., Ksenofontov A.L., Kordyukova L.V., Serebryakova M.V., Baratova L.A., Vaskovsky B.V. Isolation of the influenza A HA2 C-terminal segment by combination of nonionic detergents // Advances in Experimental Medicine and Biology. 2009. V. 611. P. 311-312.

10 Kordyukova L.V., Serebryakova M.V., Polyakov V.Y., Ovchinnikova T.V., Smirnova Y.A., Fedorova N.V., Baratova L.A. Influenza A virus M1 protein structure probed by in situ limited proteolysis with bromelain // Protein and Peptide Letters. 2008. V. 15. P.

922-930.

11 Kordyukova L.V., Serebryakova M.V., Baratova L.A., Veit M. S acylation of the hemagglutinin of influenza viruses: mass spectrometry reveals site-specific attachment of stearic acid to a transmembrane cysteine // Journal of Virology. 2008. V. 82. P.

9288-9292.

Смирнова Ю.А., Кордюкова Л.В., Серебрякова М.В., Филиппова И.Ю., Лысогорская Е.Н, Баратова Л.А. Вирион вируса гриппа как субстрат протеолитических ферментов // Биоорганическая химия. 2008. Т. 34. № 3. С. 409 415.

Ксенофонтов А.Л., Бадун Г.А., Федорова Н.В., Кордюкова Л.В. Количественное определение площади гликобелков на поверхности оболочечных вирусов // Молекулярная биология. 2008. Т. 42. № 6. С. 1093-1096.

14 Serebryakova M.V., Kordyukova L.V., Baratova L.A., Markushin S.G. Mass spectrometric sequencing and acylation character analysis of C-terminal anchoring segment from Influenza A hemagglutinin // European Journal of Mass Spectrometry.

2006. V. 12. P. 51-62.

Ксенофонтов А.Л., Козловский В.С., Кордюкова Л.В., Радюхин М, Тимофеева А.В., Добров Е.Н. Определение концентрации и размера агрегатов в препаратах вируса гриппа по спектрам истинного поглощения в УФ-свете. // Молекулярная биология. 2006. Т. 40. № 1. С. 172-179.

16 Kordyukova L.V., Ksenofontov A.L., Serebryakova M.V., Ovchinnikova T.V., Fedorova N.V., Ivanova V.T., Baratova L.A. Influenza A hemagglutinin C-terminal anchoring peptide: identification and mass spectrometric study // Protein and Peptide Letters.

2004. V. 11. P. 385-391.

Иванова В.Т., Кордюкова Л.В., Маныкин А.А., Бурцева Е.И., Загорская Ю.В., Оскерко Т.А., Слепушкин А.Н.. Особенности протеолитической обработки современных вирусов гриппа А и В. Получение субвирусных частиц с использованием фермента бромелаина // Вопросы вирусологии. 2003. Т. 48. № 5.

С. 14-18.

Материалы конференций:

18 Kordyukova L.V., Serebryakova M.V., Kropotkina E.A., Veit M. Lipidation of viral proteins studied with MALDI-TOF MS // Federation of American Societies for Experimental Biology (FASEB) Science Research Conference «Protein Lipidation, Signaling, and Membrane Domains». Saxtons River (VT, USA). 2013. P2.

Кордюкова Л.В., Серебрякова М.В., Кропоткина Е.А., Veit M., Полянский А.А.

Изучение пост-трансляционной модификации (S-ацилирования) вирусных белков методом МАЛДИ-МС // Тезисы Международной научно-практической III конференции «Постгеномные методы анализа в биологии, лабораторной и клинической медицине (Postgenome 2012)». Казань (Россия). 2012. С. 146-147.

20 Serebryakova M.V., Rudneva I.A., Kropotkina E.A., Veit M., Kordyukova L.V. MALDI TOF MS: a new approach to study S-acylation of viral proteins // Abstracts of A Biochemical Society Focused Meeting «Regulation of protein trafficking and function by palmitoylation». Oxford (UK). 2012. P. 14. P011.

21 Brett K., Kordyukova L., Moeller L., Laue M., Veit M. Mutations in the cytoplasmic tail of HA in Influenza virus – with focus on S-Acylation // 3rd International Influenza Meeting. Muenster (Germany). 2012. P. 155. P110.

Кордюкова Л.В., Серебрякова М.В., Полянский А.А., Veit M. Структурные исследования трансмембранных гликопротеинов оболочечных вирусов с использованием методов протеолиза, масс-спектрометрии и MALDI-TOF молекулярного моделирования // Тезисы V Российского симпозиума «Белки и пептиды». Петрозаводск (Россия). 2011. С. 86.

23 Kordyukova L.V. Phylogeny of influenza hemagglutinin transmembrane domains:

evaluation with enzyme proteolysis, mass spectrometry and bioinformatics tools // Young Scientist Workshop «Methods to study influenza virus». Berlin (Germany).

2011. P. 27-28.

24 Kordyukova L.V., Serebryakova M.V., Veit M. Differential S-acylation with palmitate or stearate is a common feature of viral glycoproteins // Abstracts of the 19 Annual Meeting of the Society of Virology (GfV). Liepzig (Germany). 2009. P. 628. VMIT P8.

Кордюкова Л.В., Серебрякова М.В., Veit M., Смирнова Ю.А., Кропоткина Е.А., Баратова Л.А. Использование MALDI-TOF масс-спектрометрии для изучения ацилирования гемагглютинина вируса гриппа // Тезисы IV съезда Российского общества биохимиков и молекулярных биологов. Новосибирск (Россия). 2008. C.

459.

26 Kordyukova L., Serebryakova M., Smirnova Yu., Veit M. Acylation of Influenza Virus Hemagglutinin analyzed by MALDI-TOF MS //

Abstract

of the 3rd European Virology Congress. Nuremberg (Germany). 2007. P. 47. SAS008.

27 Smirnova Ju.A., Kordyukova L.V., Fedorova N.V., Baratova L.A., Serebryakova M.V., Veit М. Influenza virus membrane proteome structural investigation based on enzyme proteolysis and MALDI-TOF mass spectrometry // Proceedings of the 3rd Moscow Conference on Computational Molecular Biology (MCCMB’07). Moscow (Russia).

2007. P. 277-278.

28 Kordyukova L.V., Serebryakova M.V., Smirnova Y.A., Ovchinnikova T.V., Lysogorskaya E.N., Filippova I.Y., Baratova L.A. Influenza A virus particles as a substrate for bromelain // Journal of Peptide Science. 2006. V. 12 (S1). P. 168. Th255.

29 Kordyukova L.V., Serebryakova M.V., Smirnova Y.A., Fedorova N.V., Timofeeva A.V., Ivanova V.T., Markushin S.G., Baratova L.A. Influenza virus membrane proteins:

studying by proteomic tools // Abstracts of the 9th Chinese International Peptide Symposium. 2006. Shanghai (China). P. 45-46.

30 Kordyukova L.V., Serebryakova M.V., Ovchinnikova T.V., Ivanova V.T., Baratova L.A.

Influenza A hemagglutinin C-terminal anchoring peptide. MS identification and approach to structural study // Peptides-2004. Proceedings of the 3rd International and 28th European Peptide Symposium, eds.: M. Flegel, M. Fridkin, C. Gilon and J.

Slaninova. Kenes International, Tel-Aviv, Israel. 2005. P. 435-436.

31 Kordyukova L.V., Ksenofontov A.L., Serebryakova M.V., Ovchinnikova T.V., Fedorova N.V., Ivanova V.T., Baratova L.A. Influenza A hemagglutinin C-terminal anchoring peptide. MS identification and approach to structural study // Journal of Peptide Science. 2004. V. 10 (8). P. 165. P174.

Кордюкова Л.В., Серебрякова М.В., Овчинникова Т.В., Радюхин В.А. Протеомные исследования заякоренного в мембране С-концевого участка гемагглютинина вируса гриппа // Тезисы докладов и стендовых сообщений VII чтений, посвященных памяти академика Ю.А. Овчинникова. Москва. 2004. С. 46-47.

Кордюкова Л.В., Ксенофонтов А.Л., Федорова Н.В., Серебрякова М.В., Овчинникова Т.В., Баратова Л.А. Выделение и структурные исследования С концевого фрагмента гемагглютинина вируса гриппа А // Российский симпозиум по химии и биологии пептидов. Москва (Россия). 2003. C. 28.

34 Kordyukova L.V., Ksenofontov A.L., Fedorova N.V., Baratova L.A. Influenza A hemagglutinin C-terminal peptide: An attempt for isolation and characterization // 3rd International Symposium on Separations in BioSciencies SBS’03 «100 Years of Chromatography». Moscow (Russia). 2003. P. 135.



 

Похожие работы:





 
2013 www.netess.ru - «Бесплатная библиотека авторефератов кандидатских и докторских диссертаций»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.